AMPDB_996 | Neutrophil antibiotic peptide NP-2

PEPTIDE SUMMARY

Neutrophil antibiotic peptide NP-2

1 General Description

AMPDB ID: AMPDB_996

Protein Names: Neutrophil antibiotic peptide NP-2 (RatNP-2) (Neutrophil defensin 2)

Protein Family: Alpha-defensin family

Gene Name: Defa

Source Organism: Rattus norvegicus (Rat)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRTLTLLTALLLLALHTQAKSPQGTAEEAPDQEQLVMEDQDISISFGGDKGTALQDADVKAGVTCYCRSTRCGFRERLSGACGYRGRIYRLCCR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 9, 'N': 0, 'D': 6, 'C': 6, 'Q': 6, 'E': 5, 'G': 9, 'H': 1, 'I': 3, 'L': 12, 'K': 3, 'M': 2, 'F': 2, 'P': 2, 'S': 5, 'T': 8, 'W': 0, 'Y': 3, 'V': 3

Frequencies of Amino Acids

'A': 9.57%, 'R': 9.57%, 'N': 0%, 'D': 6.38%, 'C': 6.38%, 'Q': 6.38%, 'E': 5.32%, 'G': 9.57%, 'H': 1.06%, 'I': 3.19%, 'L': 12.77%, 'K': 3.19%, 'M': 2.13%, 'F': 2.13%, 'P': 2.13%, 'S': 5.32%, 'T': 8.51%, 'W': 0%, 'Y': 3.19%, 'V': 3.19%

Missing Amino Acid(s)

N, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10301.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.064	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.267	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.244	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.673	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.754	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.725	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.245, 0.17, 0.298 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.053	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4845	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Yount NY, Wang MS, Yuan J, et al. Rat neutrophil defensins. Precursor structures and expression during neutrophilic myelopoiesis. J Immunol. 1995;155(9):4476-84. Published 1995 Nov 1. doi:

PMID: 7594610

Citation 2: Eisenhauer P, Harwig SS, Szklarek D, et al. Polymorphic expression of defensins in neutrophils from outbred rats. Infect Immun. 1990;58(12):3899-902. Published 1990 Dec. doi:10.1128/iai.58.12.3899-3902.1990

PMID: 2254017

5.2 Protein Sequence Databases

UniProt: Q62715

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q62715

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U16685	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_775451.2

5.5 Protein-Protein Interaction Databases

STRING: 10116.ENSRNOP00000018501

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR016327, IPR006081, IPR002366, IPR006080

PANTHER: PTHR11876

PROSITE: PS00269

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000153268

KEGG: rno:286995

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000153268

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download