AMPDB_984 | Cathelicidin-B1

PEPTIDE SUMMARY

Cathelicidin-B1

1 General Description

AMPDB ID: AMPDB_984

Protein Names: Cathelicidin-B1 (CATH-B1)

Protein Family: Cathelicidin family

Gene Name: CATHB1 RCJMB04_29o22

Source Organism: Gallus gallus (Chicken)

Protein Length: 251 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MGRMWASEVLLLLLLGSSRAVTPGLDVSTAPGLDGSIPPGLDGSVSPGLDGSVSPGLDGSASPGLDGSVSPGLDGSASPGLDGSTPAGRDGTITPKLEGTITPKQDGSISPSWPWRWPITYLDAILAAVRLLNQKISGPCILRLREAQPRPGWVGTLQRRREVSFLVEDGPCPPGVDCRSCEPGALQHCVGTVSIEQQPTAELRCRPLRPQPIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 22, 'N': 4, 'D': 13, 'C': 6, 'Q': 10, 'E': 9, 'G': 30, 'H': 2, 'I': 13, 'L': 29, 'K': 4, 'M': 2, 'F': 2, 'P': 29, 'S': 25, 'T': 13, 'W': 9, 'Y': 2, 'V': 15

Frequencies of Amino Acids

'A': 4.78%, 'R': 8.76%, 'N': 1.59%, 'D': 5.18%, 'C': 2.39%, 'Q': 3.98%, 'E': 3.59%, 'G': 11.95%, 'H': 0.8%, 'I': 5.18%, 'L': 11.55%, 'K': 1.59%, 'M': 0.8%, 'F': 0.8%, 'P': 11.55%, 'S': 9.96%, 'T': 5.18%, 'W': 3.59%, 'Y': 0.8%, 'V': 5.98%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, H, M, Y

Hydrophobic Amino Acid(s) Count

141

Hydrophilic Amino Acid(s) Count

110

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	26926.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.371	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	58.504	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.269	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.646	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.62	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.827	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.279, 0.351, 0.207 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.052	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	52480, 52855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Goitsuka R, Chen CL, Benyon L, et al. Chicken cathelicidin-B1, an antimicrobial guardian at the mucosal M cell gateway. Proc Natl Acad Sci U S A. 2007;104(38):15063-8. Published 2007 Sep 18. doi:10.1073/pnas.0707037104

PMID: 17827276

Citation 2: Caldwell RB, Kierzek AM, Arakawa H, et al. Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis. Genome Biol. 2005;6(1):R6. Published 2005. doi:10.1186/gb-2004-6-1-r6

PMID: 15642098

5.2 Protein Sequence Databases

UniProt: Q5F378

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q5F378

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB307733	GenBank \|\| EMBL
2.	AB308318	GenBank \|\| EMBL
3.	AJ851772	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001258101.1

5.5 Protein-Protein Interaction Databases

STRING: 9031.ENSGALP00000042265

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR046350

PANTHER: PTHR10206

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: gga:100858412

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download