AMPDB_954 | Defensin Cg-Defm
PEPTIDE SUMMARY
Defensin Cg-Defm
1 General Description
AMPDB ID: AMPDB_954
Protein Names: Defensin Cg-Defm (Cg-Def) (Mantle defensin)
Protein Family: Invertebrate defensin family
Gene Name: Nil
Source Organism: Crassostrea gigas (Pacific oyster) (Crassostrea angulata)
Protein Length: 65 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKVFVLLTLAVLLMVSADMAFAGFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 2, 'N': 4, 'D': 3, 'C': 8, 'Q': 1, 'E': 0, 'G': 5, 'H': 1, 'I': 1, 'L': 8, 'K': 5, 'M': 3, 'F': 3, 'P': 1, 'S': 3, 'T': 4, 'W': 1, 'Y': 1, 'V': 4
Frequencies of Amino Acids
'A': 10.77%, 'R': 3.08%, 'N': 6.15%, 'D': 4.62%, 'C': 12.31%, 'Q': 1.54%, 'E': 0%, 'G': 7.69%, 'H': 1.54%, 'I': 1.54%, 'L': 12.31%, 'K': 7.69%, 'M': 4.62%, 'F': 4.62%, 'P': 1.54%, 'S': 4.62%, 'T': 6.15%, 'W': 1.54%, 'Y': 1.54%, 'V': 6.15%
Missing Amino Acid(s)
E
Most Occurring Amino Acid(s)
C, L
Less Occurring Amino Acid(s)
H, I, P, Q, W, Y
Hydrophobic Amino Acid(s) Count
33
Hydrophilic Amino Acid(s) Count
32
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
8
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7008.37 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 82.615 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 29.912 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.426 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.443 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.409 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 3.592 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.277, 0.2, 0.277 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.077 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 6990, 7490 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
M.maritypicum (Not characterize), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Gueguen Y, Herpin A, Aumelas A, et al. Characterization of a defensin from the oyster Crassostrea gigas. Recombinant production, folding, solution structure, antimicrobial activities, and gene expression. J Biol Chem. 2006;281(1):313-23. Published 2006 Jan 6. doi:10.1074/jbc.M510850200
PMID: 16246846
Citation 2: Schmitt P, Gueguen Y, Desmarais E, et al. Molecular diversity of antimicrobial effectors in the oyster Crassostrea gigas. BMC Evol Biol. 2010;10:23. Published 2010 Jan 25. doi:10.1186/1471-2148-10-23
PMID: 20100329
Citation 3: Schmitt P, Wilmes M, Pugnière M, et al. Insight into invertebrate defensin mechanism of action: oyster defensins inhibit peptidoglycan biosynthesis by binding to lipid II. J Biol Chem. 2010;285(38):29208-16. Published 2010 Sep 17. doi:10.1074/jbc.M110.143388
PMID: 20605792
5.2 Protein Sequence Databases
UniProt: Q4GWV4
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: Q4GWV4
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. FJ669403 GenBank || EMBL
2. FJ669404 GenBank || EMBL
3. FJ669406 GenBank || EMBL
4. FJ669407 GenBank || EMBL
5. FJ669409 GenBank || EMBL
6. FJ669410 GenBank || EMBL
7. FJ669325 GenBank || EMBL
8. FJ669326 GenBank || EMBL
9. FJ669328 GenBank || EMBL
10. FJ669332 GenBank || EMBL
11. FJ669335 GenBank || EMBL
12. FJ669337 GenBank || EMBL
13. FJ669338 GenBank || EMBL
14. FJ669339 GenBank || EMBL
15. FJ669340 GenBank || EMBL
16. JF766718 GenBank || EMBL
17. JF766719 GenBank || EMBL
18. JF766720 GenBank || EMBL
19. JF766721 GenBank || EMBL
20. JF766722 GenBank || EMBL
21. JF766732 GenBank || EMBL
22. JF766733 GenBank || EMBL
23. JF766734 GenBank || EMBL
24. JF766735 GenBank || EMBL
25. JF766736 GenBank || EMBL
26. JF766739 GenBank || EMBL
27. JF766741 GenBank || EMBL
28. JF766742 GenBank || EMBL
29. AM050547 GenBank || EMBL
30. AJ565499 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR001542, IPR036574
PANTHER: Not found
PROSITE: PS51378
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India