AMPDB_948 | Defensin beta 136

PEPTIDE SUMMARY

Defensin beta 136

1 General Description

AMPDB ID: AMPDB_948

Protein Names: Defensin beta 136 (Beta-defensin 136) (DEFB137)

Protein Family: Beta-defensin family

Gene Name: DEFB136

Source Organism: Homo sapiens (Human)

Protein Length: 78 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MNLCLSALLFFLVILLPSGKGMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDPWVH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 3, 'N': 4, 'D': 2, 'C': 7, 'Q': 3, 'E': 0, 'G': 6, 'H': 2, 'I': 3, 'L': 8, 'K': 5, 'M': 3, 'F': 7, 'P': 6, 'S': 4, 'T': 3, 'W': 2, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 5.13%, 'R': 3.85%, 'N': 5.13%, 'D': 2.56%, 'C': 8.97%, 'Q': 3.85%, 'E': 0%, 'G': 7.69%, 'H': 2.56%, 'I': 3.85%, 'L': 10.26%, 'K': 6.41%, 'M': 3.85%, 'F': 8.97%, 'P': 7.69%, 'S': 5.13%, 'T': 3.85%, 'W': 2.56%, 'Y': 1.28%, 'V': 6.41%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8755.47 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	78.718	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	55.778	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.303	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.604	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.953	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.745	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.333, 0.256, 0.192 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.128	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12865	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Patil AA, Cai Y, Sang Y, et al. Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract. Physiol Genomics. 2005;23(1):5-17. Published 2005 Sep 21. doi:10.1152/physiolgenomics.00104.2005

PMID: 16033865

Citation 2: Liu H, Diao H, Hou J, et al. Soluble expression and purification of human Î²-defensin DEFB136 in Escherichia coli and identification of its bioactivity. Protein Expr Purif. 2021;188:105968. Published 2021 Dec. doi:10.1016/j.pep.2021.105968

PMID: 34481960

5.2 Protein Sequence Databases

UniProt: Q30KP8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q30KP8

5.4 Nucleotide Sequence Databases