AMPDB_942 | Antimicrobial peptide NK-lysin

PEPTIDE SUMMARY

Antimicrobial peptide NK-lysin

1 General Description

AMPDB ID: AMPDB_942

Protein Names: Antimicrobial peptide NK-lysin (NKL)

Protein Family: Nil

Gene Name: NKL

Source Organism: Sus scrofa (Pig)

Protein Length: 129 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

PGLAFSGLTPEHSALARAHPCDGEQFCQNLAPEDPQGDQLLQREELGLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKEKTGLI

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 8, 'N': 2, 'D': 8, 'C': 8, 'Q': 9, 'E': 9, 'G': 9, 'H': 2, 'I': 11, 'L': 13, 'K': 12, 'M': 3, 'F': 3, 'P': 8, 'S': 5, 'T': 6, 'W': 0, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 6.2%, 'R': 6.2%, 'N': 1.55%, 'D': 6.2%, 'C': 6.2%, 'Q': 6.98%, 'E': 6.98%, 'G': 6.98%, 'H': 1.55%, 'I': 8.53%, 'L': 10.08%, 'K': 9.3%, 'M': 2.33%, 'F': 2.33%, 'P': 6.2%, 'S': 3.88%, 'T': 4.65%, 'W': 0%, 'Y': 0%, 'V': 3.88%

Missing Amino Acid(s)

W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14316.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.476	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.336	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.866	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.211	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.7	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.248, 0.186, 0.256 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.023	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.calcoaceticus (Gram-negative), B.megaterium, E.coli (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Andersson M, Gunne H, Agerberth B, et al. NK-lysin, a novel effector peptide of cytotoxic T and NK cells. Structure and cDNA cloning of the porcine form, induction by interleukin 2, antibacterial and antitumour activity. EMBO J. 1995;14(8):1615-25. Published 1995 Apr 18. doi:10.1002/j.1460-2075.1995.tb07150.x

PMID: 7737114

Citation 2: Liepinsh E, Andersson M, Ruysschaert JM, et al. Saposin fold revealed by the NMR structure of NK-lysin. Nat Struct Biol. 1997;4(10):793-5. Published 1997 Oct. doi:10.1038/nsb1097-793

PMID: 9334742

5.2 Protein Sequence Databases

UniProt: Q29075

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q29075

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X85431	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 9823.ENSSSCP00000008784

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR038847, IPR007856, IPR008138, IPR011001, IPR008139

PANTHER: PTHR15541

PROSITE: PS50015

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download