AMPDB_939 | Lysozyme-like protein 5

PEPTIDE SUMMARY

Lysozyme-like protein 5

1 General Description

AMPDB ID: AMPDB_939

Protein Names: Lysozyme-like protein 5

Protein Family: Glycosyl hydrolase 25 family

Gene Name: lys-5 F58B3.2

Source Organism: Caenorhabditis elegans

Protein Length: 215 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKHFFITILLFCSVVSAARNGIDINSPVSTSTFTCIKNAGFSFIIPRIYHSSGSVDTVGVQNVKNARAAGLTDVDGYIFPCLKSTCASAANQVKASLDAVKAAGTKISTLWLDIERLNWPADHASNRAFIEAMVSEAKAYGQQVGIYSNYYNWQDIVGLDYHGQSSLMLWWPAYDGVKDFSKYAPFGGWSKPTIHQWSDTTTGPCGVSVDMNYIP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 21, 'R': 5, 'N': 11, 'D': 13, 'C': 5, 'Q': 7, 'E': 3, 'G': 16, 'H': 5, 'I': 16, 'L': 11, 'K': 11, 'M': 4, 'F': 10, 'P': 9, 'S': 22, 'T': 13, 'W': 7, 'Y': 10, 'V': 16

Frequencies of Amino Acids

'A': 9.77%, 'R': 2.33%, 'N': 5.12%, 'D': 6.05%, 'C': 2.33%, 'Q': 3.26%, 'E': 1.4%, 'G': 7.44%, 'H': 2.33%, 'I': 7.44%, 'L': 5.12%, 'K': 5.12%, 'M': 1.86%, 'F': 4.65%, 'P': 4.19%, 'S': 10.23%, 'T': 6.05%, 'W': 3.26%, 'Y': 4.65%, 'V': 7.44%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

110

Hydrophilic Amino Acid(s) Count

105

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	23528.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.326	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	24.084	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.001	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.611	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.453	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.142	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.326, 0.27, 0.181 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.126	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	53400, 53650	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.thuringiensis (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antimicrobial, Bacteriolytic enzyme, Anti-gram-Positive

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: C. elegans Sequencing Consortium. Genome sequence of the nematode C. elegans: a platform for investigating biology. Science. 1998;282(5396):2012-8. Published 1998 Dec 11. doi:10.1126/science.282.5396.2012

PMID: 9851916

Citation 2: Boehnisch C, Wong D, Habig M, et al. Protist-type lysozymes of the nematode Caenorhabditis elegans contribute to resistance against pathogenic Bacillus thuringiensis. PLoS One. 2011;6(9):e24619. Published 2011. doi:10.1371/journal.pone.0024619

PMID: 21931778

Citation 3: Visvikis O, Ihuegbu N, Labed SA, et al. Innate host defense requires TFEB-mediated transcription of cytoprotective and antimicrobial genes. Immunity. 2014;40(6):896-909. Published 2014 Jun 19. doi:10.1016/j.immuni.2014.05.002

PMID: 24882217

5.2 Protein Sequence Databases

UniProt: Q20967

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q20967

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	BX284604	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_502193.1

5.5 Protein-Protein Interaction Databases

STRING: 6239.F58B3.2

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002053, IPR017853

PANTHER: Not found

PROSITE: PS51904

5.8 Genome Annotation Databases

Ensembl: ENSGT00970000195882

KEGG: cel:CELE_F58B3.2

5.9 Phylogenomic Databases

GeneTree: ENSGT00970000195882

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download