AMPDB_932 | M-zodatoxin-Lt2a

PEPTIDE SUMMARY

M-zodatoxin-Lt2a

1 General Description

AMPDB ID: AMPDB_932

Protein Names: M-zodatoxin-Lt2a (M-ZDTX-Lt2a) (Latarcin-2a) (Ltc-2a) (Ltc2a)

Protein Family: Cationic peptide 03 (latarcin) family; 02 subfamily

Gene Name: Nil

Source Organism: Lachesana tarabaevi (Spider)

Protein Length: 84 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKYFVIALALAVALVCIAESTAYEVNEELENELDDLDDAAWLAVAEELQGLEDFEESRGLFGKLIKKFGRKAISYAVKKARGKH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 3, 'N': 2, 'D': 5, 'C': 1, 'Q': 1, 'E': 11, 'G': 5, 'H': 1, 'I': 4, 'L': 11, 'K': 8, 'M': 1, 'F': 4, 'P': 0, 'S': 3, 'T': 1, 'W': 1, 'Y': 3, 'V': 6

Frequencies of Amino Acids

'A': 15.48%, 'R': 3.57%, 'N': 2.38%, 'D': 5.95%, 'C': 1.19%, 'Q': 1.19%, 'E': 13.1%, 'G': 5.95%, 'H': 1.19%, 'I': 4.76%, 'L': 13.1%, 'K': 9.52%, 'M': 1.19%, 'F': 4.76%, 'P': 0%, 'S': 3.57%, 'T': 1.19%, 'W': 1.19%, 'Y': 3.57%, 'V': 7.14%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, H, M, Q, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9363.75 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	105.833	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	30.662	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.004	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.899	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.533	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.956	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.345, 0.119, 0.429 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 9970	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.globiformis (Gram-positive), B.subtilis (Gram-positive), E.coli (Gram-negative), P.aeruginosa (Gram-negative), P.pastoris, S.cerevisiae

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kozlov SA, Vassilevski AA, Feofanov AV, et al. Latarcins, antimicrobial and cytolytic peptides from the venom of the spider Lachesana tarabaevi (Zodariidae) that exemplify biomolecular diversity. J Biol Chem. 2006;281(30):20983-20992. Published 2006 Jul 28. doi:10.1074/jbc.M602168200

PMID: 16735513

Citation 2: Kuzmenkov AI, Sachkova MY, Kovalchuk SI, et al. Lachesana tarabaevi, an expert in membrane-active toxins. Biochem J. 2016;473(16):2495-506. Published 2016 Aug 15. doi:10.1042/BCJ20160436

PMID: 27287558

Citation 3: Dubovskii PV, Volynsky PE, Polyansky AA, et al. Spatial structure and activity mechanism of a novel spider antimicrobial peptide. Biochemistry. 2006;45(35):10759-67. Published 2006 Sep 5. doi:10.1021/bi060635w

PMID: 16939228

5.2 Protein Sequence Databases

UniProt: Q1ELU1

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q1ELU1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AM232698	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR018802

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download