AMPDB_923 | Antimicrobial peptide aurelin

PEPTIDE SUMMARY

Antimicrobial peptide aurelin

1 General Description

AMPDB ID: AMPDB_923

Protein Names: Antimicrobial peptide aurelin

Protein Family: Sea anemone type 1 potassium channel toxin family

Gene Name: Nil

Source Organism: Aurelia aurita (Moon jellyfish) (Medusa aurita)

Protein Length: 84 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MGCFKVLVLFAAILCMSLLVCAEDEVNLQAQIEEGPMEAIRSRRAACSDRAHGHICESFKSFCKDSGRNGVKLRANCKKTCGLC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 6, 'N': 3, 'D': 3, 'C': 9, 'Q': 2, 'E': 6, 'G': 6, 'H': 2, 'I': 4, 'L': 8, 'K': 6, 'M': 3, 'F': 4, 'P': 1, 'S': 6, 'T': 1, 'W': 0, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 10.71%, 'R': 7.14%, 'N': 3.57%, 'D': 3.57%, 'C': 10.71%, 'Q': 2.38%, 'E': 7.14%, 'G': 7.14%, 'H': 2.38%, 'I': 4.76%, 'L': 9.52%, 'K': 7.14%, 'M': 3.57%, 'F': 4.76%, 'P': 1.19%, 'S': 7.14%, 'T': 1.19%, 'W': 0%, 'Y': 0%, 'V': 5.95%

Missing Amino Acid(s)

W, Y

Most Occurring Amino Acid(s)

A, C

Less Occurring Amino Acid(s)

P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9183.82 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.691	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	57.608	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.115	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.626	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.148	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.632	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.19, 0.31 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.048	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.megaterium, B.mycoides (Gram-positive), B.subtilis (Gram-positive), E.coli (Gram-negative), L.monocytogenes (Gram-positive), M.luteus (Gram-negative), M.phlei (Gram-positive), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ovchinnikova TV, Balandin SV, Aleshina GM, et al. Aurelin, a novel antimicrobial peptide from jellyfish Aurelia aurita with structural features of defensins and channel-blocking toxins. Biochem Biophys Res Commun. 2006;348(2):514-23. Published 2006 Sep 22. doi:10.1016/j.bbrc.2006.07.078

PMID: 16890198

Citation 2: Shenkarev ZO, Panteleev PV, Balandin SV, et al. Recombinant expression and solution structure of antimicrobial peptide aurelin from jellyfish Aurelia aurita. Biochem Biophys Res Commun. 2012;429(1-2):63-9. Published 2012 Dec 7. doi:10.1016/j.bbrc.2012.10.092

PMID: 23137541

5.2 Protein Sequence Databases

UniProt: Q0MWV8

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q0MWV8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	DQ837210	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR003582

PANTHER: Not found

PROSITE: PS51670

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download