AMPDB_922 | Apidaecins type 73

PEPTIDE SUMMARY

Apidaecins type 73

1 General Description

AMPDB ID: AMPDB_922

Protein Names: Apidaecins type 73 [Cleaved into: Apidaecin; Apidaecin-1B (Apidaecin IB); Apidaecin-1A (Apidaecin IA)]

Protein Family: Apidaecin family

Gene Name: APID73

Source Organism: Apis mellifera (Honeybee)

Protein Length: 283 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

KNFALAILVVTFVVAVFGNTNLDPPTRPTRLRREAKPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAELEAEPGNNRPVYISQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAELEAEPGNNRPVYISQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAKPEAKPGNNRPVYIPQPRPPHPRI

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 21, 'R': 47, 'N': 21, 'D': 1, 'C': 0, 'Q': 9, 'E': 33, 'G': 10, 'H': 9, 'I': 11, 'L': 14, 'K': 4, 'M': 0, 'F': 3, 'P': 71, 'S': 2, 'T': 4, 'W': 0, 'Y': 9, 'V': 14

Frequencies of Amino Acids

'A': 7.42%, 'R': 16.61%, 'N': 7.42%, 'D': 0.35%, 'C': 0%, 'Q': 3.18%, 'E': 11.66%, 'G': 3.53%, 'H': 3.18%, 'I': 3.89%, 'L': 4.95%, 'K': 1.41%, 'M': 0%, 'F': 1.06%, 'P': 25.09%, 'S': 0.71%, 'T': 1.41%, 'W': 0%, 'Y': 3.18%, 'V': 4.95%

Missing Amino Acid(s)

C, M, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

144

Hydrophilic Amino Acid(s) Count

139

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	32695 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	56.219	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	72.397	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.434	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.604	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.476	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	17.866	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.18, 0.367, 0.24 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.042	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13410, 13410	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Casteels-Josson K, Capaci T, Casteels P, et al. Apidaecin multipeptide precursor structure: a putative mechanism for amplification of the insect antibacterial response. EMBO J. 1993;12(4):1569-78. Published 1993 Apr. doi:10.1002/j.1460-2075.1993.tb05801.x

PMID: 8467807

Citation 2: Casteels P, Ampe C, Jacobs F, et al. Apidaecins: antibacterial peptides from honeybees. EMBO J. 1989;8(8):2387-91. Published 1989 Aug. doi:10.1002/j.1460-2075.1989.tb08368.x

PMID: 2676519

Citation 3: Casteels P, Romagnolo J, Castle M, et al. Biodiversity of apidaecin-type peptide antibiotics. Prospects of manipulating the antibacterial spectrum and combating acquired resistance. J Biol Chem. 1994;269(42):26107-15. Published 1994 Oct 21. doi:

PMID: 7929322

5.2 Protein Sequence Databases

UniProt: Q06602

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q06602

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X72577	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004828

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download