AMPDB_912 | 2S seed storage albumin protein

PEPTIDE SUMMARY

2S seed storage albumin protein

1 General Description

AMPDB ID: AMPDB_912

Protein Names: 2S seed storage albumin protein (2S albumin) (To-A1) [Cleaved into: 2S albumin small chain; 2S albumin large chain]

Protein Family: 2S seed storage albumins family

Gene Name: Nil

Source Organism: Taraxacum officinale (Common dandelion) (Leontodon taraxacum)

Protein Length: 44 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 4, 'N': 2, 'D': 1, 'C': 6, 'Q': 13, 'E': 4, 'G': 2, 'H': 0, 'I': 1, 'L': 2, 'K': 0, 'M': 1, 'F': 1, 'P': 1, 'S': 4, 'T': 0, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 0%, 'R': 9.09%, 'N': 4.55%, 'D': 2.27%, 'C': 13.64%, 'Q': 29.55%, 'E': 9.09%, 'G': 4.55%, 'H': 0%, 'I': 2.27%, 'L': 4.55%, 'K': 0%, 'M': 2.27%, 'F': 2.27%, 'P': 2.27%, 'S': 9.09%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 4.55%

Missing Amino Acid(s)

A, H, K, T, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, I, M, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5162.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	39.773	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	83.355	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.214	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.498	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.707	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.366	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.136, 0.205, 0.159 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.023	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 375	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

P.betae

4.2 Antimicrobial Activity

Antimicrobial, Fungicide

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Odintsova TI, Rogozhin EA, Sklyar IV, et al. Antifungal activity of storage 2S albumins from seeds of the invasive weed dandelion Taraxacum officinale Wigg. Protein Pept Lett. 2010;17(4):522-9. Published 2010 Apr. doi:10.2174/092986610790963591

PMID: 19594427

5.2 Protein Sequence Databases

UniProt: P86783

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P86783

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036312

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download