AMPDB_9 | Kawaguchipeptin peptide

PEPTIDE SUMMARY

Kawaguchipeptin peptide

1 General Description

AMPDB ID: AMPDB_9

Protein Names: Kawaguchipeptin peptide (Cyclic cyanobactin) [Cleaved into: Kawaguchipeptin A (Non-posttranslationnaly modified kawaguchipeptin B)]

Protein Family: Nil

Gene Name: kgpE OA58_19045

Source Organism: Microcystis aeruginosa (strain NIES-88 KW-MA1-3)

Protein Length: 87 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKNPTLLPKLTAPVERPAVTSSDLKQASSVDAAWLNGDNNWSTPFAGVNAAWLNGDNNWSTPFAGVNAAWLNGDNNWSTPFAADGAE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 14, 'R': 1, 'N': 12, 'D': 6, 'C': 0, 'Q': 1, 'E': 2, 'G': 6, 'H': 0, 'I': 0, 'L': 7, 'K': 3, 'M': 1, 'F': 3, 'P': 7, 'S': 7, 'T': 6, 'W': 6, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 16.09%, 'R': 1.15%, 'N': 13.79%, 'D': 6.9%, 'C': 0%, 'Q': 1.15%, 'E': 2.3%, 'G': 6.9%, 'H': 0%, 'I': 0%, 'L': 8.05%, 'K': 3.45%, 'M': 1.15%, 'F': 3.45%, 'P': 8.05%, 'S': 8.05%, 'T': 6.9%, 'W': 6.9%, 'Y': 0%, 'V': 5.75%

Missing Amino Acid(s)

C, H, I, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, Q, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9216.05 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	64.138	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	23.303	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.407	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.549	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.011	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.997	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.241, 0.368, 0.276 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.103	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	33000, 33000	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Parajuli A, Kwak DH, Dalponte L, et al. A Unique Tryptophan C-Prenyltransferase from the Kawaguchipeptin Biosynthetic Pathway. Angew Chem Int Ed Engl. 2016;55(11):3596-9. Published 2016 Mar 7. doi:10.1002/anie.201509920

PMID: 26846478

Citation 2: Parajuli A, Kwak DH, Dalponte L, et al. Corrigendum: A Unique Tryptophan C-Prenyltransferase from the Kawaguchipeptin Biosynthetic Pathway. Angew Chem Int Ed Engl. 2017;56(2):433. Published 2017 Jan 9. doi:10.1002/anie.201609949

PMID: 28045232

Citation 3: Ishida K, Matsuda H, Murakami M, et al. Kawaguchipeptin B, an antibacterial cyclic undecapeptide from the cyanobacterium Microcystis aeruginosa. J Nat Prod. 1997;60(7):724-6. Published 1997 Jul. doi:10.1021/np970146k

PMID: 9249979

5.2 Protein Sequence Databases

UniProt: A0A139GI49

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A139GI49

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JXYX01000010	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_061432710.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download