AMPDB_894 | M-zodatoxin-Lt8g

PEPTIDE SUMMARY

M-zodatoxin-Lt8g

1 General Description

AMPDB ID: AMPDB_894

Protein Names: M-zodatoxin-Lt8g (M-ZDTX-Lt8g) (Cytoinsectotoxin-1g) (CIT-1g)

Protein Family: Cationic peptide 06 (cytoinsectotoxin) family

Gene Name: cit 1-8

Source Organism: Lachesana tarabaevi (Spider)

Protein Length: 129 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKYFVVALALVAAFACIAESKPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEARGFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYVLKHYGKKALQKASEKL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 19, 'R': 2, 'N': 2, 'D': 6, 'C': 1, 'Q': 3, 'E': 17, 'G': 5, 'H': 3, 'I': 6, 'L': 14, 'K': 21, 'M': 4, 'F': 4, 'P': 1, 'S': 6, 'T': 1, 'W': 2, 'Y': 3, 'V': 9

Frequencies of Amino Acids

'A': 14.73%, 'R': 1.55%, 'N': 1.55%, 'D': 4.65%, 'C': 0.78%, 'Q': 2.33%, 'E': 13.18%, 'G': 3.88%, 'H': 2.33%, 'I': 4.65%, 'L': 10.85%, 'K': 16.28%, 'M': 3.1%, 'F': 3.1%, 'P': 0.78%, 'S': 4.65%, 'T': 0.78%, 'W': 1.55%, 'Y': 2.33%, 'V': 6.98%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14522 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	95.426	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.834	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.309	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.642	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.602	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.233	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.295, 0.109, 0.419 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.07	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Cytolytic, Insecticidal, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Vassilevski AA, Kozlov SA, Samsonova OV, et al. Cyto-insectotoxins, a novel class of cytolytic and insecticidal peptides from spider venom. Biochem J. 2008;411(3):687-96. Published 2008 May 1. doi:10.1042/bj20071123

PMID: 18215128

Citation 2: Kuzmenkov AI, Sachkova MY, Kovalchuk SI, et al. Lachesana tarabaevi, an expert in membrane-active toxins. Biochem J. 2016;473(16):2495-506. Published 2016 Aug 15. doi:10.1042/BCJ20160436

PMID: 27287558

5.2 Protein Sequence Databases

UniProt: P85259

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P85259

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FM165480	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download