AMPDB_891 | Defensin-like peptide

PEPTIDE SUMMARY

Defensin-like peptide

1 General Description

AMPDB ID: AMPDB_891

Protein Names: Defensin-like peptide

Protein Family: Invertebrate defensin family; Type 2 subfamily

Gene Name: Nil

Source Organism: Galleria mellonella (Greater wax moth)

Protein Length: 44 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

DKLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFWNVNCWCEE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 2, 'N': 4, 'D': 2, 'C': 6, 'Q': 0, 'E': 3, 'G': 6, 'H': 1, 'I': 1, 'L': 1, 'K': 3, 'M': 0, 'F': 1, 'P': 0, 'S': 3, 'T': 2, 'W': 3, 'Y': 2, 'V': 2

Frequencies of Amino Acids

'A': 4.55%, 'R': 4.55%, 'N': 9.09%, 'D': 4.55%, 'C': 13.64%, 'Q': 0%, 'E': 6.82%, 'G': 13.64%, 'H': 2.27%, 'I': 2.27%, 'L': 2.27%, 'K': 6.82%, 'M': 0%, 'F': 2.27%, 'P': 0%, 'S': 6.82%, 'T': 4.55%, 'W': 6.82%, 'Y': 4.55%, 'V': 4.55%

Missing Amino Acid(s)

M, P, Q

Most Occurring Amino Acid(s)

C, G

Less Occurring Amino Acid(s)

F, H, I, L

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4949.49 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	35.455	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.348	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.655	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.548	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.039	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.279	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.227, 0.295, 0.136 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.136	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	19480, 19855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.niger, C.albicans, C.albidus, C.fructus, C.wickerhamii, E.coli (Gram-negative), F.oxysporum, L.monocytogenes (Gram-positive), M.luteus (Gram-negative), P.pastoris, P.tannophilus, S.lutea (Gram-negative), T.harzianum

4.2 Antimicrobial Activity

Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: CytryÅska M, Mak P, Zdybicka-Barabas A, et al. Purification and characterization of eight peptides from Galleria mellonella immune hemolymph. Peptides. 2007;28(3):533-46. Published 2007 Mar. doi:10.1016/j.peptides.2006.11.010

PMID: 17194500

5.2 Protein Sequence Databases

UniProt: P85215

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P85215

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download