AMPDB_88 | Lysozyme-like protein 6
PEPTIDE SUMMARY
Lysozyme-like protein 6
1 General Description
AMPDB ID: AMPDB_88
Protein Names: Lysozyme-like protein 6 (EC 3.2.1.17)
Protein Family: Glycosyl hydrolase 22 family
Gene Name: LYZL6 LYC1 UNQ754 PRO1485
Source Organism: Homo sapiens (Human)
Protein Length: 148 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 9, 'R': 7, 'N': 11, 'D': 9, 'C': 8, 'Q': 5, 'E': 6, 'G': 9, 'H': 4, 'I': 7, 'L': 23, 'K': 5, 'M': 2, 'F': 7, 'P': 2, 'S': 14, 'T': 2, 'W': 5, 'Y': 7, 'V': 6
Frequencies of Amino Acids
'A': 6.08%, 'R': 4.73%, 'N': 7.43%, 'D': 6.08%, 'C': 5.41%, 'Q': 3.38%, 'E': 4.05%, 'G': 6.08%, 'H': 2.7%, 'I': 4.73%, 'L': 15.54%, 'K': 3.38%, 'M': 1.35%, 'F': 4.73%, 'P': 1.35%, 'S': 9.46%, 'T': 1.35%, 'W': 3.38%, 'Y': 4.73%, 'V': 4.05%
Missing Amino Acid(s)
No Amino Acid(s) are missing in this protein
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
M, P, T
Hydrophobic Amino Acid(s) Count
70
Hydrophilic Amino Acid(s) Count
78
Basic Amino Acid(s) Count
15
Acidic Amino Acid(s) Count
16
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 16956.4 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 96.892 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 29.243 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.011 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.638 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.075 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -3.127 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.372, 0.243, 0.27 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.128 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 37930, 38430 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Micrococcus luteus (Gram-positive), Staphylococcus aureus (Gram-positive)
4.2 Antimicrobial Activity
Antimicrobial, Bacteriolytic enzyme, Anti-gram-Positive
4.3 Enzymatic Activity
Glycosidase, Hydrolase
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Nomiyama H, Fukuda S, Iio M, et al. Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, HCC-1, LEC, and RANTES. J Interferon Cytokine Res. 1999;19(3):227-34. Published 1999 Mar. doi:10.1089/107999099314153
PMID: 10213461
Citation 2: Zhang K, Gao R, Zhang H, et al. Molecular cloning and characterization of three novel lysozyme-like genes, predominantly expressed in the male reproductive system of humans, belonging to the c-type lysozyme/alpha-lactalbumin family. Biol Reprod. 2005;73(5):1064-71. Published 2005 Nov. doi:10.1095/biolreprod.105.041889
PMID: 16014814
Citation 3: Clark HF, Gurney AL, Abaya E, et al. The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003;13(10):2265-70. Published 2003 Oct. doi:10.1101/gr.1293003
PMID: 12975309
Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504
PMID: 15489334
Citation 5: Wei J, Li SJ, Shi H, et al. Characterisation of Lyzls in mice and antibacterial properties of human LYZL6. Asian J Androl. 2013;15(6):824-30. Published 2013 Nov. doi:10.1038/aja.2013.93
PMID: 24013621
Citation 6: Huang P, Li W, Yang Z, et al. LYZL6, an acidic, bacteriolytic, human sperm-related protein, plays a role in fertilization. PLoS One. 2017;12(2):e0171452. Published 2017. doi:10.1371/journal.pone.0171452
PMID: 28182716
5.2 Protein Sequence Databases
UniProt: O75951
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: O75951
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF088219 GenBank || EMBL
2. AY742214 GenBank || EMBL
3. AY359018 GenBank || EMBL
4. BC054481 GenBank || EMBL
5.5 Protein-Protein Interaction Databases
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: 121408
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PROSITE: PS00128, PS51348
5.8 Genome Annotation Databases
KEGG: hsa:57151
5.9 Phylogenomic Databases
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: O75951




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India