AMPDB_871 | Phylloseptin-H5

PEPTIDE SUMMARY

Phylloseptin-H5

1 General Description

AMPDB ID: AMPDB_871

Protein Names: Phylloseptin-H5 (PLS-H5) (Phylloseptin-7) (PS-7)

Protein Family: Frog skin active peptide (FSAP) family; Phylloseptin subfamily

Gene Name: psn7 psn-7

Source Organism: Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa hypochondrialis)

Protein Length: 66 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSICEEEKRETEEEENEQEDDDKSEEKRFLSLIPHAINAVSAIAKHFG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 2, 'N': 2, 'D': 3, 'C': 1, 'Q': 1, 'E': 12, 'G': 2, 'H': 2, 'I': 4, 'L': 9, 'K': 6, 'M': 1, 'F': 5, 'P': 1, 'S': 6, 'T': 1, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 7.58%, 'R': 3.03%, 'N': 3.03%, 'D': 4.55%, 'C': 1.52%, 'Q': 1.52%, 'E': 18.18%, 'G': 3.03%, 'H': 3.03%, 'I': 6.06%, 'L': 13.64%, 'K': 9.09%, 'M': 1.52%, 'F': 7.58%, 'P': 1.52%, 'S': 9.09%, 'T': 1.52%, 'W': 0%, 'Y': 0%, 'V': 4.55%

Missing Amino Acid(s)

W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, P, Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7553.58 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	97.576	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	61.244	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.265	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.656	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.38	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.861	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.318, 0.167, 0.409 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.076	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), P.aeruginosa (Gram-negative)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Chen T, Zhou M, Gagliardo R, et al. Elements of the granular gland peptidome and transcriptome persist in air-dried skin of the South American orange-legged leaf frog, Phyllomedusa hypocondrialis. Peptides. 2006;27(9):2129-36. Published 2006 Sep. doi:10.1016/j.peptides.2006.04.006

PMID: 16713656

Citation 2: ConceiÃ§Ã£o K, Konno K, Richardson M, et al. Isolation and biochemical characterization of peptides presenting antimicrobial activity from the skin of Phyllomedusa hypochondrialis. Peptides. 2006;27(12):3092-9. Published 2006 Dec. doi:10.1016/j.peptides.2006.08.005

PMID: 16963159

Citation 3: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017

PMID: 18644413

5.2 Protein Sequence Databases

UniProt: P84572

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P84572

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AM229010	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download