AMPDB_87 | Peptidoglycan recognition protein 1
PEPTIDE SUMMARY
Peptidoglycan recognition protein 1
1 General Description
AMPDB ID: AMPDB_87
Protein Names: Peptidoglycan recognition protein 1 (Peptidoglycan recognition protein short) (PGRP-S)
Protein Family: N-acetylmuramoyl-L-alanine amidase 2 family
Gene Name: PGLYRP1 PGLYRP PGRP TNFSF3L SBBI68 UNQ639 PRO1269
Source Organism: Homo sapiens (Human)
Protein Length: 196 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 18, 'R': 13, 'N': 10, 'D': 5, 'C': 7, 'Q': 12, 'E': 6, 'G': 17, 'H': 9, 'I': 6, 'L': 21, 'K': 3, 'M': 6, 'F': 3, 'P': 12, 'S': 16, 'T': 7, 'W': 6, 'Y': 8, 'V': 11
Frequencies of Amino Acids
'A': 9.18%, 'R': 6.63%, 'N': 5.1%, 'D': 2.55%, 'C': 3.57%, 'Q': 6.12%, 'E': 3.06%, 'G': 8.67%, 'H': 4.59%, 'I': 3.06%, 'L': 10.71%, 'K': 1.53%, 'M': 3.06%, 'F': 1.53%, 'P': 6.12%, 'S': 8.16%, 'T': 3.57%, 'W': 3.06%, 'Y': 4.08%, 'V': 5.61%
Missing Amino Acid(s)
No Amino Acid(s) are missing in this protein
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
F, K
Hydrophobic Amino Acid(s) Count
100
Hydrophilic Amino Acid(s) Count
96
Basic Amino Acid(s) Count
11
Acidic Amino Acid(s) Count
25
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 21730.8 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 79.184 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 59.514 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.262 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.767 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.676 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 5.387 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.281, 0.281, 0.26 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.087 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 44920, 45295 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Chemotaxis, Cytotoxin, Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Kang D, Liu G, Lundström A, et al. A peptidoglycan recognition protein in innate immunity conserved from insects to humans. Proc Natl Acad Sci U S A. 1998;95(17):10078-82. Published 1998 Aug 18. doi:10.1073/pnas.95.17.10078
PMID: 9707603
Citation 2: Clark HF, Gurney AL, Abaya E, et al. The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003;13(10):2265-70. Published 2003 Oct. doi:10.1101/gr.1293003
PMID: 12975309
Citation 3: Grimwood J, Gordon LA, Olsen A, et al. The DNA sequence and biology of human chromosome 19. Nature. 2004;428(6982):529-35. Published 2004 Apr 1. doi:10.1038/nature02399
PMID: 15057824
Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504
PMID: 15489334
Citation 5: Liu C, Xu Z, Gupta D, et al. Peptidoglycan recognition proteins: a novel family of four human innate immunity pattern recognition molecules. J Biol Chem. 2001;276(37):34686-94. Published 2001 Sep 14. doi:10.1074/jbc.M105566200
PMID: 11461926
Citation 6: Lu X, Wang M, Qi J, et al. Peptidoglycan recognition proteins are a new class of human bactericidal proteins. J Biol Chem. 2006;281(9):5895-907. Published 2006 Mar 3. doi:10.1074/jbc.M511631200
PMID: 16354652
Citation 7: Guan R, Wang Q, Sundberg EJ, et al. Crystal structure of human peptidoglycan recognition protein S (PGRP-S) at 1.70 A resolution. J Mol Biol. 2005;347(4):683-91. Published 2005 Apr 8. doi:10.1016/j.jmb.2005.01.070
PMID: 15769462
Citation 8: Yashin DV, Dukhanina EA, Kabanova OD, et al. The heat shock-binding protein (HspBP1) protects cells against the cytotoxic action of the Tag7-Hsp70 complex. J Biol Chem. 2011;286(12):10258-64. Published 2011 Mar 25. doi:10.1074/jbc.M110.163436
PMID: 21247889
Citation 9: Yashin DV, Ivanova OK, Soshnikova NV, et al. Tag7 (PGLYRP1) in Complex with Hsp70 Induces Alternative Cytotoxic Processes in Tumor Cells via TNFR1 Receptor. J Biol Chem. 2015;290(35):21724-31. Published 2015 Aug 28. doi:10.1074/jbc.M115.639732
PMID: 26183779
Citation 10: Read CB, Kuijper JL, Hjorth SA, et al. Cutting Edge: identification of neutrophil PGLYRP1 as a ligand for TREM-1. J Immunol. 2015;194(4):1417-21. Published 2015 Feb 15. doi:10.4049/jimmunol.1402303
PMID: 25595774
Citation 11: Dukhanina EA, Lukyanova TI, Romanova EA, et al. A new role for PGRP-S (Tag7) in immune defense: lymphocyte migration is induced by a chemoattractant complex of Tag7 with Mts1. Cell Cycle. 2015;14(22):3635-43. Published 2015. doi:10.1080/15384101.2015.1104440
PMID: 26654597
Citation 12: Sharapova TN, Ivanova OK, Prasolov VS, et al. Innate immunity protein Tag7 (PGRP-S) activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells. IUBMB Life. 2017;69(12):971-977. Published 2017 Dec. doi:10.1002/iub.1688
PMID: 29083508
Citation 13: Sharapova TN, Ivanova OK, Soshnikova NV, et al. Innate Immunity Protein Tag7 Induces 3 Distinct Populations of Cytotoxic Cells That Use Different Mechanisms to Exhibit Their Antitumor Activity on Human Leukocyte Antigen-Deficient Cancer Cells. J Innate Immun. 2017;9(6):598-608. Published 2017. doi:10.1159/000479382
PMID: 28977785
Citation 14: Sharapova TN, Romanova EA, Sashchenko LP, et al. Tag7-Mts1 Complex Induces Lymphocytes Migration via CCR5 and CXCR3 Receptors. Acta Naturae. 2018;10(4):115-120. Published 2018 Oct-Dec. doi:
PMID: 30713770
5.2 Protein Sequence Databases
UniProt: O75594
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: O75594
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF076483 GenBank || EMBL
2. AF242517 GenBank || EMBL
3. AY358936 GenBank || EMBL
4. AC007785 GenBank || EMBL
5. BC096154 GenBank || EMBL
6. BC096155 GenBank || EMBL
7. BC096156 GenBank || EMBL
8. BC096157 GenBank || EMBL
9. BC101845 GenBank || EMBL
10. BC101847 GenBank || EMBL
CCDS: CCDS12680.1
RefSeq: NP_005082.1
5.5 Protein-Protein Interaction Databases
STRING: 9606.ENSP00000008938
IntAct: O75594
MINT: O75594
DIP: Not found
BioGRID: 114474
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR036505, IPR002502, IPR017331, IPR015510, IPR006619
PANTHER: PTHR11022
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: ENSGT00940000161006
KEGG: hsa:8993
5.9 Phylogenomic Databases
GeneTree: ENSGT00940000161006
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: O75594




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India