AMPDB_855 | Cupiennin-1a

1 General Description

AMPDB ID: AMPDB_855

Protein Names: Cupiennin-1a (Cu-1a) (M-ctenitoxin-Cs1a) (M-CNTX-Cs1a)

Protein Family: Cationic peptide 04 (cupiennin) family; 01 subfamily

Gene Name: Nil

Source Organism: Cupiennius salei (American wandering spider)

Protein Length: 35 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME

FASTA format

Counts of Amino Acids

'A': 7, 'R': 0, 'N': 1, 'D': 0, 'C': 0, 'Q': 3, 'E': 1, 'G': 3, 'H': 0, 'I': 0, 'L': 2, 'K': 8, 'M': 1, 'F': 3, 'P': 0, 'S': 0, 'T': 1, 'W': 0, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 20%, 'R': 0%, 'N': 2.86%, 'D': 0%, 'C': 0%, 'Q': 8.57%, 'E': 2.86%, 'G': 8.57%, 'H': 0%, 'I': 0%, 'L': 5.71%, 'K': 22.86%, 'M': 2.86%, 'F': 8.57%, 'P': 0%, 'S': 0%, 'T': 2.86%, 'W': 0%, 'Y': 2.86%, 'V': 11.43%

Missing Amino Acid(s)

C, D, H, I, P, R, S, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, M, N, T, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3799.58 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.429	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.206	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.131	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.694	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.046	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.997	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.286, 0.114, 0.314 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.114	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1490	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), E.faecalis (Gram-positive), P.aeruginosa (Gram-negative), P.denitrificans (Gram-negative), P.putida (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Insecticidal, Synergistic peptide, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Kuhn-Nentwig L, Muller J, Schaller J, et al. Cupiennin 1, a new family of highly basic antimicrobial peptides in the venom of the spider Cupiennius salei (Ctenidae). J Biol Chem. 2002;277(13):11208-16. Published 2002 Mar 29. doi:10.1074/jbc.M111099200

PMID: 11792701

Citation 2: Haeberli S, Kuhn-Nentwig L, Schaller J, et al. Characterisation of antibacterial activity of peptides isolated from the venom of the spider Cupiennius salei (Araneae: Ctenidae). Toxicon. 2000;38(3):373-80. Published 2000 Mar. doi:10.1016/s0041-0101(99)00167-1

PMID: 10669026

Citation 3: Wullschleger B, Nentwig W, Kuhn-Nentwig L, et al. Spider venom: enhancement of venom efficacy mediated by different synergistic strategies in Cupiennius salei. J Exp Biol. 2005;208(Pt 11):2115-21. Published 2005 Jun. doi:10.1242/jeb.01594

PMID: 15914655

Citation 4: Pukala TL, Doyle JR, Llewellyn LE, et al. Cupiennin 1a, an antimicrobial peptide from the venom of the neotropical wandering spider Cupiennius salei, also inhibits the formation of nitric oxide by neuronal nitric oxide synthase. FEBS J. 2007;274(7):1778-84. Published 2007 Apr. doi:10.1111/j.1742-4658.2007.05726.x

PMID: 17313650

Citation 5: Pukala TL, Boland MP, Gehman JD, et al. Solution structure and interaction of cupiennin 1a, a spider venom peptide, with phospholipid bilayers. Biochemistry. 2007;46(11):3576-85. Published 2007 Mar 20. doi:10.1021/bi062306+

PMID: 17319697

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P83619

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR035164

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download