AMPDB_85 | Lysozyme-like protein 1

PEPTIDE SUMMARY

Lysozyme-like protein 1

1 General Description

AMPDB ID: AMPDB_85

Protein Names: Lysozyme-like protein 1

Protein Family: Glycosyl hydrolase 25 family

Gene Name: lys-1 Y22F5A.4

Source Organism: Caenorhabditis elegans

Protein Length: 298 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MLKLAFVTFLFALASARPQDVDSNRVVALPQDNFEVTDIGFEKIKAEPAPEVVNNDASYAYAVDISVPTTVSQMNCLKTSRYAAVFIRGFTPFGSGAFDTTSVTSIRNAYSAGLGIEVYMTPQPLSSLQGYQQLDALYNGLNGNGITIRSVWIQVTSPANWQKSATTNVNFLNSIISRAKQYGLTVGIYTNQYDWSQITGNWATLSSDVLLWYWHVLGGGVTGETPATFDDFRAFGSFKKASVKQFAQVESVCSLTVNRDVYVVGIPAAASSKNTDFFTQEDISSNNKKIVVGGVIGV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 27, 'R': 9, 'N': 19, 'D': 15, 'C': 2, 'Q': 15, 'E': 8, 'G': 22, 'H': 1, 'I': 17, 'L': 19, 'K': 12, 'M': 3, 'F': 17, 'P': 11, 'S': 28, 'T': 24, 'W': 6, 'Y': 12, 'V': 31

Frequencies of Amino Acids

'A': 9.06%, 'R': 3.02%, 'N': 6.38%, 'D': 5.03%, 'C': 0.67%, 'Q': 5.03%, 'E': 2.68%, 'G': 7.38%, 'H': 0.34%, 'I': 5.7%, 'L': 6.38%, 'K': 4.03%, 'M': 1.01%, 'F': 5.7%, 'P': 3.69%, 'S': 9.4%, 'T': 8.05%, 'W': 2.01%, 'Y': 4.03%, 'V': 10.4%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

153

Hydrophilic Amino Acid(s) Count

145

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	32379.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	86.342	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.361	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.031	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.655	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.303	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.028	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.342, 0.268, 0.191 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.117	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	50880, 51005	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive), S.marcescens (Gram-negative)

4.2 Antimicrobial Activity

Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: C. elegans Sequencing Consortium. Genome sequence of the nematode C. elegans: a platform for investigating biology. Science. 1998;282(5396):2012-8. Published 1998 Dec 11. doi:10.1126/science.282.5396.2012

PMID: 9851916

Citation 2: Mallo GV, Kurz CL, Couillault C, et al. Inducible antibacterial defense system in C. elegans. Curr Biol. 2002;12(14):1209-14. Published 2002 Jul 23. doi:10.1016/s0960-9822(02)00928-4

PMID: 12176330

Citation 3: Jensen VL, Simonsen KT, Lee YH, et al. RNAi screen of DAF-16/FOXO target genes in C. elegans links pathogenesis and dauer formation. PLoS One. 2010;5(12):e15902. Published 2010 Dec 31. doi:10.1371/journal.pone.0015902

PMID: 21209831

Citation 4: Boehnisch C, Wong D, Habig M, et al. Protist-type lysozymes of the nematode Caenorhabditis elegans contribute to resistance against pathogenic Bacillus thuringiensis. PLoS One. 2011;6(9):e24619. Published 2011. doi:10.1371/journal.pone.0024619

PMID: 21931778

5.2 Protein Sequence Databases

UniProt: O62415

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O62415

5.4 Nucleotide Sequence Databases