AMPDB_848 | Spheniscin-2

PEPTIDE SUMMARY

Spheniscin-2

1 General Description

AMPDB ID: AMPDB_848

Protein Names: Spheniscin-2 (Sphe-2) (pBD-2)

Protein Family: Beta-defensin family

Gene Name: Nil

Source Organism: Aptenodytes patagonicus (King penguin)

Protein Length: 38 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 10, 'N': 0, 'D': 0, 'C': 6, 'Q': 1, 'E': 0, 'G': 4, 'H': 0, 'I': 2, 'L': 2, 'K': 0, 'M': 0, 'F': 4, 'P': 2, 'S': 3, 'T': 0, 'W': 1, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 2.63%, 'R': 26.32%, 'N': 0%, 'D': 0%, 'C': 15.79%, 'Q': 2.63%, 'E': 0%, 'G': 10.53%, 'H': 0%, 'I': 5.26%, 'L': 5.26%, 'K': 0%, 'M': 0%, 'F': 10.53%, 'P': 5.26%, 'S': 7.89%, 'T': 0%, 'W': 2.63%, 'Y': 0%, 'V': 5.26%

Missing Amino Acid(s)

D, E, H, K, M, N, T, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4507.43 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	58.947	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	52.947	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.095	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.777	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	12.132	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.626	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.289, 0.237, 0.079 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.132	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5875	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Thouzeau C, Le Maho Y, Froget G, et al. Spheniscins, avian beta-defensins in preserved stomach contents of the king penguin, Aptenodytes patagonicus. J Biol Chem. 2003;278(51):51053-8. Published 2003 Dec 19. doi:10.1074/jbc.M306839200

PMID: 14525994

Citation 2: Landon C, Thouzeau C, LabbÃ© H, et al. Solution structure of spheniscin, a beta-defensin from the penguin stomach. J Biol Chem. 2004;279(29):30433-9. Published 2004 Jul 16. doi:10.1074/jbc.M401338200

PMID: 15123713

5.2 Protein Sequence Databases

UniProt: P83430

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P83430

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download