AMPDB_839 | Opistoporin-1

1 General Description

AMPDB ID: AMPDB_839

Protein Names: Opistoporin-1 (OP1) (Non-disulfide-bridged peptide 2.4) (NDBP-2.4) (Non-disulfide-bridged peptide 3.5) (NDBP-3.5) (Opistoporin-3) (OP3)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Long chain multifunctional peptide (group 2) family

Gene Name: Nil

Source Organism: Opistophthalmus carinatus (African yellow leg scorpion)

Protein Length: 82 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MNRKLLFVTLMVTMLVMQPSEGGKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPSEAGQMPFDEFMDILYE

FASTA format

Counts of Amino Acids

'A': 7, 'R': 1, 'N': 5, 'D': 3, 'C': 0, 'Q': 2, 'E': 7, 'G': 4, 'H': 0, 'I': 3, 'L': 9, 'K': 9, 'M': 6, 'F': 3, 'P': 4, 'S': 4, 'T': 5, 'W': 3, 'Y': 1, 'V': 6

Frequencies of Amino Acids

'A': 8.54%, 'R': 1.22%, 'N': 6.1%, 'D': 3.66%, 'C': 0%, 'Q': 2.44%, 'E': 8.54%, 'G': 4.88%, 'H': 0%, 'I': 3.66%, 'L': 10.98%, 'K': 10.98%, 'M': 7.32%, 'F': 3.66%, 'P': 4.88%, 'S': 4.88%, 'T': 6.1%, 'W': 3.66%, 'Y': 1.22%, 'V': 7.32%

Missing Amino Acid(s)

C, H

Most Occurring Amino Acid(s)

K, L

Less Occurring Amino Acid(s)

R, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9274.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	86.829	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.548	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.152	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.62	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.817	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.008	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.305, 0.207, 0.354 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.085	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	17990, 17990	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Moerman L, Bosteels S, Noppe W, et al. Antibacterial and antifungal properties of alpha-helical, cationic peptides in the venom of scorpions from southern Africa. Eur J Biochem. 2002;269(19):4799-810. Published 2002 Oct. doi:10.1046/j.1432-1033.2002.03177.x

PMID: 12354111

Citation 2: Willems J, Noppe W, Moerman L, et al. Cationic peptides from scorpion venom can stimulate and inhibit polymorphonuclear granulocytes. Toxicon. 2002;40(12):1679-83. Published 2002 Dec. doi:10.1016/s0041-0101(02)00183-6

PMID: 12457879

Citation 3: Moerman L, Verdonck F, Willems J, et al. Antimicrobial peptides from scorpion venom induce Ca(2+) signaling in HL-60 cells. Biochem Biophys Res Commun. 2003;311(1):90-7. Published 2003 Nov 7. doi:10.1016/j.bbrc.2003.09.175

PMID: 14575699

Citation 4: Zeng XC, Corzo G, Hahin R, et al. Scorpion venom peptides without disulfide bridges. IUBMB Life. 2005;57(1):13-21. Published 2005 Jan. doi:10.1080/15216540500058899

PMID: 16036557

Citation 5: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P83313

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY427948	GenBank \|\| EMBL
2.	AY427950	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012526

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download