AMPDB_836 | Maximins 4 H3 type 1
PEPTIDE SUMMARY
Maximins 4 H3 type 1
1 General Description
AMPDB ID: AMPDB_836
Protein Names: Maximins 4 H3 type 1 [Cleaved into: Maximin-4; Maximin-H3]
Protein Family: Bombinin family
Gene Name: Nil
Protein Length: 144 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MNFKYIIAVSFFIASAYARSEEKDVQSLSQRDVLEEESLREIRGIGGVLLSAGKAALKGLAKVLAEKYANGKRTAEDHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKEKRILGPVLGLVGNALGGLIKKIG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 15, 'R': 10, 'N': 5, 'D': 6, 'C': 0, 'Q': 3, 'E': 17, 'G': 13, 'H': 2, 'I': 9, 'L': 17, 'K': 13, 'M': 3, 'F': 5, 'P': 2, 'S': 9, 'T': 3, 'W': 0, 'Y': 3, 'V': 9
Frequencies of Amino Acids
'A': 10.42%, 'R': 6.94%, 'N': 3.47%, 'D': 4.17%, 'C': 0%, 'Q': 2.08%, 'E': 11.81%, 'G': 9.03%, 'H': 1.39%, 'I': 6.25%, 'L': 11.81%, 'K': 9.03%, 'M': 2.08%, 'F': 3.47%, 'P': 1.39%, 'S': 6.25%, 'T': 2.08%, 'W': 0%, 'Y': 2.08%, 'V': 6.25%
Missing Amino Acid(s)
C, W
Most Occurring Amino Acid(s)
E, L
Less Occurring Amino Acid(s)
H, P
Hydrophobic Amino Acid(s) Count
73
Hydrophilic Amino Acid(s) Count
71
Basic Amino Acid(s) Count
23
Acidic Amino Acid(s) Count
25
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 15903.3 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 98.958 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 44.951 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.296 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.654 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.681 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.206 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.299, 0.201, 0.361 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.056 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 4470, 4470 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria and Gram Positive Bacteria
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-HIV, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Cytotoxin, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Lai R, Zheng YT, Shen JH, et al. Antimicrobial peptides from skin secretions of Chinese red belly toad Bombina maxima. Peptides. 2002;23(3):427-35. Published 2002 Mar. doi:10.1016/s0196-9781(01)00641-6
PMID: 11835991
Citation 2: Lee WH, Li Y, Lai R, et al. Variety of antimicrobial peptides in the Bombina maxima toad and evidence of their rapid diversification. Eur J Immunol. 2005;35(4):1220-9. Published 2005 Apr. doi:10.1002/eji.200425615
PMID: 15770703
5.2 Protein Sequence Databases
UniProt: P83083
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P83083
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF378907 GenBank || EMBL
2. AY848997 GenBank || EMBL
3. AY848982 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR007962
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India