AMPDB_836 | Maximins 4 H3 type 1

PEPTIDE SUMMARY

Maximins 4 H3 type 1

1 General Description

AMPDB ID: AMPDB_836

Protein Names: Maximins 4 H3 type 1 [Cleaved into: Maximin-4; Maximin-H3]

Protein Family: Bombinin family

Gene Name: Nil

Source Organism: Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)

Protein Length: 144 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFKYIIAVSFFIASAYARSEEKDVQSLSQRDVLEEESLREIRGIGGVLLSAGKAALKGLAKVLAEKYANGKRTAEDHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKEKRILGPVLGLVGNALGGLIKKIG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 15, 'R': 10, 'N': 5, 'D': 6, 'C': 0, 'Q': 3, 'E': 17, 'G': 13, 'H': 2, 'I': 9, 'L': 17, 'K': 13, 'M': 3, 'F': 5, 'P': 2, 'S': 9, 'T': 3, 'W': 0, 'Y': 3, 'V': 9

Frequencies of Amino Acids

'A': 10.42%, 'R': 6.94%, 'N': 3.47%, 'D': 4.17%, 'C': 0%, 'Q': 2.08%, 'E': 11.81%, 'G': 9.03%, 'H': 1.39%, 'I': 6.25%, 'L': 11.81%, 'K': 9.03%, 'M': 2.08%, 'F': 3.47%, 'P': 1.39%, 'S': 6.25%, 'T': 2.08%, 'W': 0%, 'Y': 2.08%, 'V': 6.25%

Missing Amino Acid(s)

C, W

Most Occurring Amino Acid(s)

E, L

Less Occurring Amino Acid(s)

H, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15903.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	98.958	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.951	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.296	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.654	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.681	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.206	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.299, 0.201, 0.361 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-HIV, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lai R, Zheng YT, Shen JH, et al. Antimicrobial peptides from skin secretions of Chinese red belly toad Bombina maxima. Peptides. 2002;23(3):427-35. Published 2002 Mar. doi:10.1016/s0196-9781(01)00641-6

PMID: 11835991

Citation 2: Lee WH, Li Y, Lai R, et al. Variety of antimicrobial peptides in the Bombina maxima toad and evidence of their rapid diversification. Eur J Immunol. 2005;35(4):1220-9. Published 2005 Apr. doi:10.1002/eji.200425615

PMID: 15770703

5.2 Protein Sequence Databases

UniProt: P83083

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P83083

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF378907	GenBank \|\| EMBL
2.	AY848997	GenBank \|\| EMBL
3.	AY848982	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007962

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download