AMPDB_834 | Hepcidin

PEPTIDE SUMMARY

Hepcidin

1 General Description

AMPDB ID: AMPDB_834

Protein Names: Hepcidin

Protein Family: Hepcidin family

Gene Name: hamp

Source Organism: Morone chrysops x Morone saxatilis (White bass x Striped bass)

Protein Length: 85 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTFSVAVAVAVVLAFICLQESSAVPVTEVQELEEPMSNEYQEMPVESWKMPYNNRHKRHSSPGGCRFCCNCCPNMSGCGVCCRF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 4, 'N': 5, 'D': 0, 'C': 9, 'Q': 3, 'E': 8, 'G': 4, 'H': 2, 'I': 1, 'L': 3, 'K': 3, 'M': 5, 'F': 4, 'P': 6, 'S': 8, 'T': 2, 'W': 1, 'Y': 2, 'V': 10

Frequencies of Amino Acids

'A': 5.88%, 'R': 4.71%, 'N': 5.88%, 'D': 0%, 'C': 10.59%, 'Q': 3.53%, 'E': 9.41%, 'G': 4.71%, 'H': 2.35%, 'I': 1.18%, 'L': 3.53%, 'K': 3.53%, 'M': 5.88%, 'F': 4.71%, 'P': 7.06%, 'S': 9.41%, 'T': 2.35%, 'W': 1.18%, 'Y': 2.35%, 'V': 11.76%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9483.99 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	58.353	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	90.789	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.053	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.474	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.455	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.366	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.247, 0.271, 0.247 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Signal peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Shike H, Lauth X, Westerman ME, et al. Bass hepcidin is a novel antimicrobial peptide induced by bacterial challenge. Eur J Biochem. 2002;269(8):2232-7. Published 2002 Apr. doi:10.1046/j.1432-1033.2002.02881.x

PMID: 11985602

Citation 2: Lauth X, Babon JJ, Stannard JA, et al. Bass hepcidin synthesis, solution structure, antimicrobial activities and synergism, and in vivo hepatic response to bacterial infections. J Biol Chem. 2005;280(10):9272-82. Published 2005 Mar 11. doi:10.1074/jbc.M411154200

PMID: 15546886

5.2 Protein Sequence Databases

UniProt: P82951

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P82951

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF394245	GenBank \|\| EMBL
2.	AF394246	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR010500

PANTHER: PTHR16877

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download