AMPDB_83 | Lantibiotic mutacin-2

1 General Description

AMPDB ID: AMPDB_83

Protein Names: Lantibiotic mutacin-2 (Lantibiotic mutacin H-29B) (Mutacin II)

Protein Family: Type A lantibiotic family

Gene Name: mutA

Source Organism: Streptococcus mutans

Protein Length: 53 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MNKLNSNAVVSLNEVSDSELDTILGGNRWWQGVVPTVSYECRMNSWQHVFTCC

FASTA format

Counts of Amino Acids

'A': 1, 'R': 2, 'N': 6, 'D': 2, 'C': 3, 'Q': 2, 'E': 3, 'G': 3, 'H': 1, 'I': 1, 'L': 4, 'K': 1, 'M': 2, 'F': 1, 'P': 1, 'S': 6, 'T': 3, 'W': 3, 'Y': 1, 'V': 7

Frequencies of Amino Acids

'A': 1.89%, 'R': 3.77%, 'N': 11.32%, 'D': 3.77%, 'C': 5.66%, 'Q': 3.77%, 'E': 5.66%, 'G': 5.66%, 'H': 1.89%, 'I': 1.89%, 'L': 7.55%, 'K': 1.89%, 'M': 3.77%, 'F': 1.89%, 'P': 1.89%, 'S': 11.32%, 'T': 5.66%, 'W': 5.66%, 'Y': 1.89%, 'V': 13.21%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, F, H, I, K, P, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6019.77 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	76.981	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.779	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.194	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.549	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.665	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.092	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.321, 0.302, 0.189 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.094	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	17990, 18115	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

A.viscosus (Gram-positive), C.diphtheriae (Gram-positive), C.jejuni (Gram-negative), C.sporogenes (Gram-negative), G.vaginalis (Gram-positive), H.pylori (Gram-negative), L.monocytogenes (Gram-positive), M.luteus (Gram-negative), M.smegmatis (Gram-positive), P.acidilactici (Gram-positive), P.acnes, P.micros, S.aureus (Gram-positive), Streptococcus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Woodruff WA, Novak J, Caufield PW, et al. Sequence analysis of mutA and mutM genes involved in the biosynthesis of the lantibiotic mutacin II in Streptococcus mutans. Gene. 1998;206(1):37-43. Published 1998 Jan 5. doi:10.1016/s0378-1119(97)00578-7

PMID: 9461412

Citation 2: Krull RE, Chen P, Novak J, et al. Biochemical structural analysis of the lantibiotic mutacin II. J Biol Chem. 2000;275(21):15845-50. Published 2000 May 26. doi:10.1074/jbc.275.21.15845

PMID: 10821848

Citation 3: Nicolas G, Morency H, LaPointe G, et al. Mutacin H-29B is identical to mutacin II (J-T8). BMC Microbiol. 2006;6:36. Published 2006 Apr 20. doi:10.1186/1471-2180-6-36

PMID: 16626493

Citation 4: Chen P, Novak J, Kirk M, et al. Structure-activity study of the lantibiotic mutacin II from Streptococcus mutans T8 by a gene replacement strategy. Appl Environ Microbiol. 1998;64(7):2335-40. Published 1998 Jul. doi:10.1128/AEM.64.7.2335-2340.1998

PMID: 9647795

Citation 5: NovÃ¡k J, Caufield PW, Miller EJ, et al. Isolation and biochemical characterization of a novel lantibiotic mutacin from Streptococcus mutans. J Bacteriol. 1994;176(14):4316-20. Published 1994 Jul. doi:10.1128/jb.176.14.4316-4320.1994

PMID: 8021218

Citation 6: Chikindas ML, NovÃ¡k J, Driessen AJ, et al. Mutacin II, a bactericidal antibiotic from Streptococcus mutans. Antimicrob Agents Chemother. 1995;39(12):2656-60. Published 1995 Dec. doi:10.1128/AAC.39.12.2656

PMID: 8592997

Citation 7: NovÃ¡k J, Kirk M, Caufield PW, et al. Detection of modified amino acids in lantibiotic peptide mutacin II by chemical derivation and electrospray ionization-mass spectroscopic analysis. Anal Biochem. 1996;236(2):358-60. Published 1996 May 1. doi:10.1006/abio.1996.0181

PMID: 8660519

Citation 8: Chen P, Qi FX, Novak J, et al. Effect of amino acid substitutions in conserved residues in the leader peptide on biosynthesis of the lantibiotic mutacin II. FEMS Microbiol Lett. 2001;195(2):139-44. Published 2001 Feb 20. doi:10.1111/j.1574-6968.2001.tb10511.x

PMID: 11179642

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: O54329

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U40620	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007682

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download