AMPDB_828 | Gomesin

PEPTIDE SUMMARY

Gomesin

1 General Description

AMPDB ID: AMPDB_828

Protein Names: Gomesin

Protein Family: Nil

Gene Name: Nil

Source Organism: Acanthoscurria gomesiana (Tarantula spider) (Phormictopus pheopygus)

Protein Length: 84 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNRTRLFACLLLAVLILVHESNAQCRRLCYKQRCVTYCRGRGKRSLDETNVGTSDVEKRAFDDSNVPSLVEERELEDEGSFIFD

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 10, 'N': 4, 'D': 6, 'C': 5, 'Q': 2, 'E': 8, 'G': 4, 'H': 1, 'I': 2, 'L': 10, 'K': 3, 'M': 1, 'F': 4, 'P': 1, 'S': 6, 'T': 4, 'W': 0, 'Y': 2, 'V': 7

Frequencies of Amino Acids

'A': 4.76%, 'R': 11.9%, 'N': 4.76%, 'D': 7.14%, 'C': 5.95%, 'Q': 2.38%, 'E': 9.52%, 'G': 4.76%, 'H': 1.19%, 'I': 2.38%, 'L': 11.9%, 'K': 3.57%, 'M': 1.19%, 'F': 4.76%, 'P': 1.19%, 'S': 7.14%, 'T': 4.76%, 'W': 0%, 'Y': 2.38%, 'V': 8.33%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

L, R

Less Occurring Amino Acid(s)

H, M, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9688 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	84.643	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	50.963	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.406	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.508	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.869	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.207	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.298, 0.179, 0.274 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.071	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3230	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Bacillus (Gram-positive), E.coli (Gram-negative), E.faecalis (Gram-positive), K.pneumoniae (Gram-negative), L.amazonensis, N.crassa, P.aeruginosa (Gram-negative), Salmonella (Gram-negative), Staphylococcus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-parasitic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lorenzini DM, Fukuzawa AH, da Silva PI Jr, et al. Molecular cloning, expression analysis and cellular localization of gomesin, an anti-microbial peptide from hemocytes of the spider Acanthoscurria gomesiana. Insect Biochem Mol Biol. 2003;33(10):1011-6. Published 2003 Oct. doi:10.1016/s0965-1748(03)00115-2

PMID: 14505694

Citation 2: Silva PI Jr, Daffre S, Bulet P, et al. Isolation and characterization of gomesin, an 18-residue cysteine-rich defense peptide from the spider Acanthoscurria gomesiana hemocytes with sequence similarities to horseshoe crab antimicrobial peptides of the tachyplesin family. J Biol Chem. 2000;275(43):33464-70. Published 2000 Oct 27. doi:10.1074/jbc.M001491200

PMID: 10942757

Citation 3: Mandard N, Bulet P, Caille A, et al. The solution structure of gomesin, an antimicrobial cysteine-rich peptide from the spider. Eur J Biochem. 2002;269(4):1190-8. Published 2002 Feb. doi:10.1046/j.0014-2956.2002.02760.x

PMID: 11856345

5.2 Protein Sequence Databases

UniProt: P82358

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P82358

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ544540	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download