AMPDB_827 | Termicin

PEPTIDE SUMMARY

Termicin

1 General Description

AMPDB ID: AMPDB_827

Protein Names: Termicin

Protein Family: Nil

Gene Name: Nil

Source Organism: Pseudacanthotermes spiniger

Protein Length: 36 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 4, 'N': 1, 'D': 1, 'C': 6, 'Q': 4, 'E': 0, 'G': 1, 'H': 1, 'I': 1, 'L': 0, 'K': 1, 'M': 0, 'F': 4, 'P': 0, 'S': 3, 'T': 1, 'W': 1, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 11.11%, 'R': 11.11%, 'N': 2.78%, 'D': 2.78%, 'C': 16.67%, 'Q': 11.11%, 'E': 0%, 'G': 2.78%, 'H': 2.78%, 'I': 2.78%, 'L': 0%, 'K': 2.78%, 'M': 0%, 'F': 11.11%, 'P': 0%, 'S': 8.33%, 'T': 2.78%, 'W': 2.78%, 'Y': 2.78%, 'V': 5.56%

Missing Amino Acid(s)

E, L, M, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, G, H, I, K, N, T, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4221.86 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	38.056	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	69.497	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.153	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.359	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.631	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.716	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.139, 0.111 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.167	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7365	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.fumigatus, A.viridans (Gram-positive), B.bassiana, B.megaterium, C.albicans, C.neoformans, F.culmorum, F.oxysporum, M.luteus (Gram-negative), N.crassa, S.aureus (Gram-positive), S.cerevisiae, S.pyogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lamberty M, Zachary D, Lanot R, et al. Insect immunity. Constitutive expression of a cysteine-rich antifungal and a linear antibacterial peptide in a termite insect. J Biol Chem. 2001;276(6):4085-92. Published 2001 Feb 9. doi:10.1074/jbc.M002998200

PMID: 11053427

Citation 2: Da Silva P, Jouvensal L, Lamberty M, et al. Solution structure of termicin, an antimicrobial peptide from the termite Pseudacanthotermes spiniger. Protein Sci. 2003;12(3):438-46. Published 2003 Mar. doi:10.1110/ps.0228303

PMID: 12592014

5.2 Protein Sequence Databases

UniProt: P82321

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P82321

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036574, IPR024723

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download