AMPDB_823 | Cathelicidin-2
PEPTIDE SUMMARY
Cathelicidin-2
1 General Description
AMPDB ID: AMPDB_823
Protein Names: Cathelicidin-2 (Bactenecin-5) (Bac5) (ChBac5)
Protein Family: Cathelicidin family
Gene Name: CATHL2 BAC5
Source Organism: Capra hircus (Goat)
Protein Length: 176 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
METQGASLSLGRWSLWLLLLGLVVPLASAQALSYREAVLRAVGQLNERSSEANLYRLLELDPAPNDEVDPGTRKPVSFTVKETVCPRTTQQPPEECDFKENGLVKQCVGTVTLDPSNDQFDINCNELQSVRFRPPIRRPPIRPPFNPPFRPPVRPPFRPPFRPPFRPPIGPFPGRR
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 8, 'R': 19, 'N': 8, 'D': 7, 'C': 4, 'Q': 8, 'E': 11, 'G': 9, 'H': 0, 'I': 4, 'L': 19, 'K': 4, 'M': 1, 'F': 10, 'P': 29, 'S': 10, 'T': 8, 'W': 2, 'Y': 2, 'V': 13
Frequencies of Amino Acids
'A': 4.55%, 'R': 10.8%, 'N': 4.55%, 'D': 3.98%, 'C': 2.27%, 'Q': 4.55%, 'E': 6.25%, 'G': 5.11%, 'H': 0%, 'I': 2.27%, 'L': 10.8%, 'K': 2.27%, 'M': 0.57%, 'F': 5.68%, 'P': 16.48%, 'S': 5.68%, 'T': 4.55%, 'W': 1.14%, 'Y': 1.14%, 'V': 7.39%
Missing Amino Acid(s)
H
Most Occurring Amino Acid(s)
P
Less Occurring Amino Acid(s)
M
Hydrophobic Amino Acid(s) Count
95
Hydrophilic Amino Acid(s) Count
81
Basic Amino Acid(s) Count
18
Acidic Amino Acid(s) Count
23
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 19845.8 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 76.932 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 66.106 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.506 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.699 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 9.438 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 4.77 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.284, 0.318, 0.222 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.08 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 13980, 14230 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive), S.typhimurium
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Shamova O, Brogden KA, Zhao C, et al. Purification and properties of proline-rich antimicrobial peptides from sheep and goat leukocytes. Infect Immun. 1999;67(8):4106-11. Published 1999 Aug. doi:10.1128/IAI.67.8.4106-4111.1999
PMID: 10417180
5.2 Protein Sequence Databases
UniProt: P82018
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P82018
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. Y18873 GenBank || EMBL
CCDS: Not found
5.5 Protein-Protein Interaction Databases
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: PTHR10206
PROSITE: PS00946, PS00947
5.8 Genome Annotation Databases
5.9 Phylogenomic Databases
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India