AMPDB_819 | Defensin-B

PEPTIDE SUMMARY

Defensin-B

1 General Description

AMPDB ID: AMPDB_819

Protein Names: Defensin-B

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: DEFB AAEL003857

Source Organism: Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Protein Length: 98 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKSITVICFLALCTVAITSAYPQEPVLADEARPFANSLFDELPEETYQAAVENFRLKRATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 6, 'N': 5, 'D': 4, 'C': 8, 'Q': 3, 'E': 6, 'G': 6, 'H': 1, 'I': 4, 'L': 8, 'K': 3, 'M': 1, 'F': 5, 'P': 4, 'S': 6, 'T': 5, 'W': 0, 'Y': 3, 'V': 7

Frequencies of Amino Acids

'A': 13.27%, 'R': 6.12%, 'N': 5.1%, 'D': 4.08%, 'C': 8.16%, 'Q': 3.06%, 'E': 6.12%, 'G': 6.12%, 'H': 1.02%, 'I': 4.08%, 'L': 8.16%, 'K': 3.06%, 'M': 1.02%, 'F': 5.1%, 'P': 4.08%, 'S': 6.12%, 'T': 5.1%, 'W': 0%, 'Y': 3.06%, 'V': 7.14%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10583.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.735	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.725	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.114	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.608	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.786	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.398	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.276, 0.214, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4970	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lowenberger CA, Smartt CT, Bulet P, et al. Insect immunity: molecular cloning, expression, and characterization of cDNAs and genomic DNA encoding three isoforms of insect defensin in Aedes aegypti. Insect Mol Biol. 1999;8(1):107-18. Published 1999 Feb. doi:10.1046/j.1365-2583.1999.810107.x

PMID: 9927179

Citation 2: Nene V, Wortman JR, Lawson D, et al. Genome sequence of Aedes aegypti, a major arbovirus vector. Science. 2007;316(5832):1718-23. Published 2007 Jun 22. doi:10.1126/science.1138878

PMID: 17510324

Citation 3: Lowenberger C, Bulet P, Charlet M, et al. Insect immunity: isolation of three novel inducible antibacterial defensins from the vector mosquito, Aedes aegypti. Insect Biochem Mol Biol. 1995;25(7):867-73. Published 1995 Jul. doi:10.1016/0965-1748(95)00043-u

PMID: 7633471

5.2 Protein Sequence Databases

UniProt: P81602

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P81602

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF156090	GenBank \|\| EMBL
2.	AF156091	GenBank \|\| EMBL
3.	CH477283	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download