AMPDB_817 | Phylloxin-B1

PEPTIDE SUMMARY

Phylloxin-B1

1 General Description

AMPDB ID: AMPDB_817

Protein Names: Phylloxin-B1 (PLX-B1) (Phylloxin)

Protein Family: Frog skin active peptide (FSAP) family; Phylloxin subfamily

Gene Name: PLX-B

Source Organism: Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MVFLKKSLLLVLFVGLVSLSICEENKREEHEEIEENKEKAEEKRGWMSKIASGIGTFLSGMQQG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 2, 'N': 2, 'D': 0, 'C': 1, 'Q': 2, 'E': 11, 'G': 6, 'H': 1, 'I': 4, 'L': 8, 'K': 7, 'M': 3, 'F': 3, 'P': 0, 'S': 6, 'T': 1, 'W': 1, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 3.13%, 'R': 3.13%, 'N': 3.13%, 'D': 0%, 'C': 1.56%, 'Q': 3.13%, 'E': 17.19%, 'G': 9.38%, 'H': 1.56%, 'I': 6.25%, 'L': 12.5%, 'K': 10.94%, 'M': 4.69%, 'F': 4.69%, 'P': 0%, 'S': 9.38%, 'T': 1.56%, 'W': 1.56%, 'Y': 0%, 'V': 6.25%

Missing Amino Acid(s)

D, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, H, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7256.44 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	94.375	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	69.891	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.241	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.499	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.096	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.956	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.313, 0.219, 0.375 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.063	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.laidlawii (Gram-positive), B.megaterium, C.glutamicum (Gram-positive), E.coli (Gram-negative), M.luteus (Gram-negative), S.melliferum (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Pierre TN, Seon AA, Amiche M, et al. Phylloxin, a novel peptide antibiotic of the dermaseptin family of antimicrobial/opioid peptide precursors. Eur J Biochem. 2000;267(2):370-8. Published 2000 Jan. doi:10.1046/j.1432-1327.2000.01012.x

PMID: 10632707

Citation 2: Chen T, Gagliardo R, Walker B, et al. Partial structure of the phylloxin gene from the giant monkey frog, Phyllomedusa bicolor: parallel cloning of precursor cDNA and genomic DNA from lyophilized skin secretion. Peptides. 2005;26(12):2624-8. Published 2005 Dec. doi:10.1016/j.peptides.2005.04.017

PMID: 15936849

Citation 3: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017

PMID: 18644413

5.2 Protein Sequence Databases

UniProt: P81565

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P81565

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ251876	GenBank \|\| EMBL
2.	AJ867213	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download