AMPDB_815 | Penaeidin-2a

1 General Description

AMPDB ID: AMPDB_815

Protein Names: Penaeidin-2a (P2) (Pen-2) (Pen-2a)

Protein Family: Penaeidin family

Gene Name: Nil

Source Organism: Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)

Protein Length: 72 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MRLVVCLVFLASFALVCQGEAYRGGYTGPIPRPPPIGRPPFRPVCNACYRLSVSDARNCCIKFGSCCHLVKG

FASTA format

Counts of Amino Acids

'A': 5, 'R': 7, 'N': 2, 'D': 1, 'C': 8, 'Q': 1, 'E': 1, 'G': 7, 'H': 1, 'I': 3, 'L': 6, 'K': 2, 'M': 1, 'F': 4, 'P': 8, 'S': 4, 'T': 1, 'W': 0, 'Y': 3, 'V': 7

Frequencies of Amino Acids

'A': 6.94%, 'R': 9.72%, 'N': 2.78%, 'D': 1.39%, 'C': 11.11%, 'Q': 1.39%, 'E': 1.39%, 'G': 9.72%, 'H': 1.39%, 'I': 4.17%, 'L': 8.33%, 'K': 2.78%, 'M': 1.39%, 'F': 5.56%, 'P': 11.11%, 'S': 5.56%, 'T': 1.39%, 'W': 0%, 'Y': 4.17%, 'V': 9.72%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

C, P

Less Occurring Amino Acid(s)

D, E, H, M, Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7833.37 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.889	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.361	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.339	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.695	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.99	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.592	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.319, 0.292, 0.181 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.097	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4970	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative), M.luteus (Gram-negative), N.crassa

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Destoumieux D, Bulet P, Loew D, et al. Penaeidins, a new family of antimicrobial peptides isolated from the shrimp Penaeus vannamei (Decapoda). J Biol Chem. 1997;272(45):28398-406. Published 1997 Nov 7. doi:10.1074/jbc.272.45.28398

PMID: 9353298

Citation 2: Destoumieux D, Bulet P, Strub JM, et al. Recombinant expression and range of activity of penaeidins, antimicrobial peptides from penaeid shrimp. Eur J Biochem. 1999;266(2):335-46. Published 1999 Dec. doi:10.1046/j.1432-1327.1999.00855.x

PMID: 10561573

Citation 3: Destoumieux D, MuÃ±oz M, Cosseau C, et al. Penaeidins, antimicrobial peptides with chitin-binding activity, are produced and stored in shrimp granulocytes and released after microbial challenge. J Cell Sci. 2000;113 ( Pt 3):461-9. Published 2000 Feb. doi:10.1242/jcs.113.3.461

PMID: 10639333

Citation 4: Destoumieux D, Munoz M, Bulet P, et al. Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda). Cell Mol Life Sci. 2000;57(8-9):1260-71. Published 2000 Aug. doi:10.1007/pl00000764

PMID: 11028917

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P81057

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Y14925	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR009226

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download