AMPDB_813 | Apolipophorin-3

PEPTIDE SUMMARY

Apolipophorin-3

1 General Description

AMPDB ID: AMPDB_813

Protein Names: Apolipophorin-3 (Apolipophorin-III) (ApoLp-III)

Protein Family: Insect apolipophorin-3 family

Gene Name: Nil

Source Organism: Galleria mellonella (Greater wax moth)

Protein Length: 186 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAAKYVFVVAACSALAQAGIVRRDASTPLQDLEKHAAEFQKTFSEQLNAFTNSKDTKEFNTALKEGSDSVLQQLNALASSLQKALNDANGKAKEALEQTRTNLERTAEELRRAHPDVERQAGALRDRLQTAVQATVQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 31, 'R': 9, 'N': 9, 'D': 9, 'C': 1, 'Q': 18, 'E': 16, 'G': 5, 'H': 3, 'I': 2, 'L': 19, 'K': 18, 'M': 1, 'F': 6, 'P': 3, 'S': 10, 'T': 13, 'W': 0, 'Y': 2, 'V': 11

Frequencies of Amino Acids

'A': 16.67%, 'R': 4.84%, 'N': 4.84%, 'D': 4.84%, 'C': 0.54%, 'Q': 9.68%, 'E': 8.6%, 'G': 2.69%, 'H': 1.61%, 'I': 1.08%, 'L': 10.22%, 'K': 9.68%, 'M': 0.54%, 'F': 3.23%, 'P': 1.61%, 'S': 5.38%, 'T': 6.99%, 'W': 0%, 'Y': 1.08%, 'V': 5.91%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

108

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	20452.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.85	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.995	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.669	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.781	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.055	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.234	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.215, 0.145, 0.36 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.043	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.niger, C.albicans, C.wickerhamii, E.coli (Gram-negative), F.oxysporum, L.monocytogenes (Gram-positive), M.luteus (Gram-negative), P.pastoris, S.aureus (Gram-positive), S.cerevisiae, S.lutea (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Weise C, Franke P, KopÃ¡cek P, et al. Primary structure of apolipophorin-III from the greater wax moth, Galleria mellonella. J Protein Chem. 1998;17(7):633-41. Published 1998 Oct. doi:10.1007/BF02780964

PMID: 9853677

Citation 2: CytryÅska M, Mak P, Zdybicka-Barabas A, et al. Purification and characterization of eight peptides from Galleria mellonella immune hemolymph. Peptides. 2007;28(3):533-46. Published 2007 Mar. doi:10.1016/j.peptides.2006.11.010

PMID: 17194500

Citation 3: StÄczek S, Zdybicka-Barabas A, Mak P, et al. Studies on localization and protein ligands of Galleria mellonella apolipophorin III during immune response against different pathogens. J Insect Physiol. 2018;105:18-27. Published 2018 Feb-Mar. doi:10.1016/j.jinsphys.2017.12.009

PMID: 29289504

5.2 Protein Sequence Databases

UniProt: P80703

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P80703

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ006975	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR010009

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download