AMPDB_810 | Gaegurin-4

PEPTIDE SUMMARY

Gaegurin-4

1 General Description

AMPDB ID: AMPDB_810

Protein Names: Gaegurin-4

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: GGN4

Source Organism: Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa)

Protein Length: 80 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTMKKSLLFLFFLGTISLSLCEEERSADEDDGGEMTEEEVKRGILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 2, 'N': 0, 'D': 5, 'C': 3, 'Q': 2, 'E': 8, 'G': 8, 'H': 0, 'I': 2, 'L': 11, 'K': 9, 'M': 3, 'F': 5, 'P': 0, 'S': 6, 'T': 6, 'W': 0, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 6.25%, 'R': 2.5%, 'N': 0%, 'D': 6.25%, 'C': 3.75%, 'Q': 2.5%, 'E': 10%, 'G': 10%, 'H': 0%, 'I': 2.5%, 'L': 13.75%, 'K': 11.25%, 'M': 3.75%, 'F': 6.25%, 'P': 0%, 'S': 7.5%, 'T': 7.5%, 'W': 0%, 'Y': 0%, 'V': 6.25%

Missing Amino Acid(s)

H, N, P, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, Q, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8695.11 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.75	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.025	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.01	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.723	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.787	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.174	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.288, 0.175, 0.338 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.063	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-protozoal, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kwon SY, Carlson BA, Park JM, et al. Structural organization and expression of the gaegurin 4 gene of Rana rugosa. Biochim Biophys Acta. 2000;1492(1):185-90. Published 2000 Jun 21. doi:10.1016/s0167-4781(00)00082-8

PMID: 11004488

Citation 2: Park JM, Jung JE, Lee BJ, et al. Antimicrobial peptides from the skin of a Korean frog, Rana rugosa. Biochem Biophys Res Commun. 1994;205(1):948-54. Published 1994 Nov 30. doi:10.1006/bbrc.1994.2757

PMID: 7999137

Citation 3: Chi SW, Kim JS, Kim DH, et al. Solution structure and membrane interaction mode of an antimicrobial peptide gaegurin 4. Biochem Biophys Res Commun. 2007;352(3):592-7. Published 2007 Jan 19. doi:10.1016/j.bbrc.2006.11.064

PMID: 17141187

5.2 Protein Sequence Databases

UniProt: P80398

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P80398

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U22392	GenBank \|\| EMBL
2.	AF213015	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012521, IPR018247, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download