AMPDB_809 | Antibacterial protein PR-39

1 General Description

AMPDB ID: AMPDB_809

Protein Names: Antibacterial protein PR-39

Protein Family: Cathelicidin family

Gene Name: PR39

Source Organism: Sus scrofa (Pig)

Protein Length: 172 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

METQRASLCLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLNPSIHSLDISCNEIQSVRRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFPGKR

FASTA format

Counts of Amino Acids

'A': 8, 'R': 20, 'N': 5, 'D': 6, 'C': 5, 'Q': 7, 'E': 10, 'G': 7, 'H': 1, 'I': 4, 'L': 20, 'K': 6, 'M': 1, 'F': 7, 'P': 30, 'S': 12, 'T': 7, 'W': 2, 'Y': 3, 'V': 11

Frequencies of Amino Acids

'A': 4.65%, 'R': 11.63%, 'N': 2.91%, 'D': 3.49%, 'C': 2.91%, 'Q': 4.07%, 'E': 5.81%, 'G': 4.07%, 'H': 0.58%, 'I': 2.33%, 'L': 11.63%, 'K': 3.49%, 'M': 0.58%, 'F': 4.07%, 'P': 17.44%, 'S': 6.98%, 'T': 4.07%, 'W': 1.16%, 'Y': 1.74%, 'V': 6.4%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19476.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.616	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	62.226	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.564	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.775	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.443	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.795	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.273, 0.314, 0.227 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.07	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15720	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Gudmundsson GH, Magnusson KP, Chowdhary BP, et al. Structure of the gene for porcine peptide antibiotic PR-39, a cathelin gene family member: comparative mapping of the locus for the human peptide antibiotic FALL-39. Proc Natl Acad Sci U S A. 1995;92(15):7085-9. Published 1995 Jul 18. doi:10.1073/pnas.92.15.7085

PMID: 7624374

Citation 2: Storici P, Zanetti M, Zanetti M. A cDNA derived from pig bone marrow cells predicts a sequence identical to the intestinal antibacterial peptide PR-39. Biochem Biophys Res Commun. 1993;196(3):1058-65. Published 1993 Nov 15. doi:10.1006/bbrc.1993.2358

PMID: 8250863

Citation 3: Zhao C, Ganz T, Lehrer RI, et al. Structures of genes for two cathelin-associated antimicrobial peptides: prophenin-2 and PR-39. FEBS Lett. 1995;376(3):130-4. Published 1995 Dec 4. doi:10.1016/0014-5793(95)01237-3

PMID: 7498526

Citation 4: Agerberth B, Lee JY, Bergman T, et al. Amino acid sequence of PR-39. Isolation from pig intestine of a new member of the family of proline-arginine-rich antibacterial peptides. Eur J Biochem. 1991;202(3):849-54. Published 1991 Dec 18. doi:10.1111/j.1432-1033.1991.tb16442.x

PMID: 1765098

Citation 5: Shi J, Ross CR, Chengappa MM, et al. Identification of a proline-arginine-rich antibacterial peptide from neutrophils that is analogous to PR-39, an antibacterial peptide from the small intestine. J Leukoc Biol. 1994;56(6):807-11. Published 1994 Dec. doi:10.1002/jlb.56.6.807

PMID: 7996056

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P80054

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X87236	GenBank \|\| EMBL
2.	L23825	GenBank \|\| EMBL
3.	X89201	GenBank \|\| EMBL

RefSeq: NP_999615.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: 1150284

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ssc:407610

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download