AMPDB_807 | Temporin-1Tg

PEPTIDE SUMMARY

Temporin-1Tg

1 General Description

AMPDB ID: AMPDB_807

Protein Names: Temporin-1Tg (TG) (Temporin-G)

Protein Family: Frog skin active peptide (FSAP) family; Temporin subfamily

Gene Name: Nil

Source Organism: Rana temporaria (European common frog)

Protein Length: 61 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKSLLLLFFLGTINLSLCEEERDADEERRDDLEERDVEVEKRFFPVIGRILNGILGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 6, 'N': 2, 'D': 5, 'C': 1, 'Q': 0, 'E': 9, 'G': 4, 'H': 0, 'I': 4, 'L': 11, 'K': 4, 'M': 1, 'F': 5, 'P': 1, 'S': 2, 'T': 2, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 1.64%, 'R': 9.84%, 'N': 3.28%, 'D': 8.2%, 'C': 1.64%, 'Q': 0%, 'E': 14.75%, 'G': 6.56%, 'H': 0%, 'I': 6.56%, 'L': 18.03%, 'K': 6.56%, 'M': 1.64%, 'F': 8.2%, 'P': 1.64%, 'S': 3.28%, 'T': 3.28%, 'W': 0%, 'Y': 0%, 'V': 4.92%

Missing Amino Acid(s)

H, Q, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, C, M, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7171.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	111.803	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.154	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.2	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.825	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.45	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.047	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.377, 0.148, 0.361 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), M.luteus (Gram-negative), S.cerevisiae

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-yeast, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Simmaco M, Mignogna G, Canofeni S, et al. Temporins, antimicrobial peptides from the European red frog Rana temporaria. Eur J Biochem. 1996;242(3):788-92. Published 1996 Dec 15. doi:10.1111/j.1432-1033.1996.0788r.x

PMID: 9022710

Citation 2: Samgina TY, Vasileva ID, Kovalev SV, et al. Differentiation of Central Slovenian and Moscow populations of Rana temporaria frogs using peptide biomarkers of temporins family. Anal Bioanal Chem. 2021;413(21):5333-5347. Published 2021 Sep. doi:10.1007/s00216-021-03506-1

PMID: 34235566

Citation 3: Ke T, Liang S, Huang J, et al. A novel PCR-based method for high throughput prokaryotic expression of antimicrobial peptide genes. BMC Biotechnol. 2012;12:10. Published 2012 Mar 23. doi:10.1186/1472-6750-12-10

PMID: 22439858

Citation 4: Musale V, Casciaro B, Mangoni ML, et al. Assessment of the potential of temporin peptides from the frog Rana temporaria (Ranidae) as anti-diabetic agents. J Pept Sci. 2018;24(2). Published 2018 Feb. doi:10.1002/psc.3065

PMID: 29349894

5.2 Protein Sequence Databases

UniProt: P79875

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P79875

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Y09395	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download