AMPDB_8 | Secapin

PEPTIDE SUMMARY

Secapin

1 General Description

AMPDB ID: AMPDB_8

Protein Names: Secapin (AcSecapin-1)

Protein Family: Secapin family

Gene Name: Nil

Source Organism: Apis cerana (Indian honeybee)

Protein Length: 115 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRFQVYILHLCFFILVVLTYLSQGQSYTTTTTTSTTEQPTFLQKIHETFKKVKENAKIHNLYIFDPPTWIYTTTTEKPVESTENFDITNRQLITVPVRCPPNYDFIKGRCREKIP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 5, 'N': 5, 'D': 3, 'C': 3, 'Q': 6, 'E': 7, 'G': 2, 'H': 3, 'I': 10, 'L': 8, 'K': 8, 'M': 1, 'F': 8, 'P': 8, 'S': 4, 'T': 19, 'W': 1, 'Y': 6, 'V': 7

Frequencies of Amino Acids

'A': 0.87%, 'R': 4.35%, 'N': 4.35%, 'D': 2.61%, 'C': 2.61%, 'Q': 5.22%, 'E': 6.09%, 'G': 1.74%, 'H': 2.61%, 'I': 8.7%, 'L': 6.96%, 'K': 6.96%, 'M': 0.87%, 'F': 6.96%, 'P': 6.96%, 'S': 3.48%, 'T': 16.52%, 'W': 0.87%, 'Y': 5.22%, 'V': 6.09%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, M, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13569.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	79.565	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	39.009	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.323	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.729	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.813	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.091	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.348, 0.165, 0.148 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.13	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	14440, 14565	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.bassiana, B.thuringiensis (Gram-positive), E.coli (Gram-negative), P.aeruginosa (Gram-negative), P.larvae (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Serine protease inhibitor

4.5 Other Biological Activity

Cytotoxin, Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lee KS, Kim BY, Yoon HJ, et al. Secapin, a bee venom peptide, exhibits anti-fibrinolytic, anti-elastolytic, and anti-microbial activities. Dev Comp Immunol. 2016;63:27-35. Published 2016 Oct. doi:10.1016/j.dci.2016.05.011

PMID: 27208884

5.2 Protein Sequence Databases

UniProt: A0A0K1YW63

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A0K1YW63

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KR732613	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_016905691.1, XP_016905692.1, XP_016905693.1, XP_016905694.1, XP_016905696.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR020128

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: acer:107993666

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download