AMPDB_777 | Neutrophil defensin 3
PEPTIDE SUMMARY
Neutrophil defensin 3
1 General Description
AMPDB ID: AMPDB_777
Protein Names: Neutrophil defensin 3 (RMAD-3)
Protein Family: Alpha-defensin family
Gene Name: Nil
Protein Length: 96 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MRTLVILAAILLVALQAQAEPLQARTDEATAAQEQIPTDNPEVVVSLAWDESLAPKDSVPGLRKNMACYCRIPACLAGERRYGTCFYRRRVWAFCC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 15, 'R': 9, 'N': 2, 'D': 4, 'C': 6, 'Q': 5, 'E': 6, 'G': 3, 'H': 0, 'I': 4, 'L': 10, 'K': 2, 'M': 2, 'F': 2, 'P': 6, 'S': 3, 'T': 5, 'W': 2, 'Y': 3, 'V': 7
Frequencies of Amino Acids
'A': 15.63%, 'R': 9.38%, 'N': 2.08%, 'D': 4.17%, 'C': 6.25%, 'Q': 5.21%, 'E': 6.25%, 'G': 3.13%, 'H': 0%, 'I': 4.17%, 'L': 10.42%, 'K': 2.08%, 'M': 2.08%, 'F': 2.08%, 'P': 6.25%, 'S': 3.13%, 'T': 5.21%, 'W': 2.08%, 'Y': 3.13%, 'V': 7.29%
Missing Amino Acid(s)
H
Most Occurring Amino Acid(s)
A
Less Occurring Amino Acid(s)
F, K, M, N, W
Hydrophobic Amino Acid(s) Count
51
Hydrophilic Amino Acid(s) Count
45
Basic Amino Acid(s) Count
10
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 10686.4 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 93.646 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 65.956 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.069 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.596 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.729 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.635 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.292, 0.146, 0.344 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.073 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 15470, 15845 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), L.monocytogenes (Gram-positive), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Tang YQ, Yuan J, Miller CJ, et al. Isolation, characterization, cDNA cloning, and antimicrobial properties of two distinct subfamilies of alpha-defensins from rhesus macaque leukocytes. Infect Immun. 1999;67(11):6139-44. Published 1999 Nov. doi:10.1128/IAI.67.11.6139-6144.1999
PMID: 10531277
5.2 Protein Sequence Databases
UniProt: P60031
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P60031
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF188269 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: PTHR11876
PROSITE: PS00269
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India