AMPDB_774 | Lantibiotic actagardine

1 General Description

AMPDB ID: AMPDB_774

Protein Names: Lantibiotic actagardine (Gardimycin)

Protein Family: Type B lantibiotic family

Gene Name: garA

Source Organism: Actinoplanes garbadinensis

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MSALAIEKSWKDVDLRDGATSHPAGLGFGELTFEDLREDRTIYAASSGWVCTLTIECGTVICAC

FASTA format

Counts of Amino Acids

'A': 7, 'R': 3, 'N': 0, 'D': 5, 'C': 4, 'Q': 0, 'E': 5, 'G': 6, 'H': 1, 'I': 4, 'L': 6, 'K': 2, 'M': 1, 'F': 2, 'P': 1, 'S': 5, 'T': 6, 'W': 2, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 10.94%, 'R': 4.69%, 'N': 0%, 'D': 7.81%, 'C': 6.25%, 'Q': 0%, 'E': 7.81%, 'G': 9.38%, 'H': 1.56%, 'I': 6.25%, 'L': 9.38%, 'K': 3.13%, 'M': 1.56%, 'F': 3.13%, 'P': 1.56%, 'S': 7.81%, 'T': 9.38%, 'W': 3.13%, 'Y': 1.56%, 'V': 4.69%

Missing Amino Acid(s)

N, Q

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M, P, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6882.78 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.469	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	65.744	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.136	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.479	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.214	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-5.149	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.281, 0.188, 0.297 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.078	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12740	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Boakes S, CortÃ©s J, Appleyard AN, et al. Organization of the genes encoding the biosynthesis of actagardine and engineering of a variant generation system. Mol Microbiol. 2009;72(5):1126-36. Published 2009 Jun. doi:10.1111/j.1365-2958.2009.06708.x

PMID: 19400806

Citation 2: Kettenring JK, Malabarba A, VÃ©key K, et al. Sequence determination of actagardine, a novel lantibiotic, by homonuclear 2D NMR spectroscopy. J Antibiot (Tokyo). 1990;43(9):1082-8. Published 1990 Sep. doi:10.7164/antibiotics.43.1082

PMID: 2211371

Citation 3: Zimmermann N, Metzger JW, Jung G, et al. The tetracyclic lantibiotic actagardine. 1H-NMR and 13C-NMR assignments and revised primary structure. Eur J Biochem. 1995;228(3):786-97. Published 1995 Mar 15. doi:

PMID: 7737178

Citation 4: BrÃ¶tz H, Bierbaum G, Leopold K, et al. The lantibiotic mersacidin inhibits peptidoglycan synthesis by targeting lipid II. Antimicrob Agents Chemother. 1998;42(1):154-60. Published 1998 Jan. doi:10.1128/AAC.42.1.154

PMID: 9449277

Citation 5: Zimmermann N, Jung G, Jung G. The three-dimensional solution structure of the lantibiotic murein-biosynthesis-inhibitor actagardine determined by NMR. Eur J Biochem. 1997;246(3):809-19. Published 1997 Jun 15. doi:10.1111/j.1432-1033.1997.00809.x

PMID: 9219543

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P56650

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FJ547091	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download