AMPDB_773 | Defensin-like protein

PEPTIDE SUMMARY

Defensin-like protein

1 General Description

AMPDB ID: AMPDB_773

Protein Names: Defensin-like protein (Brazzein)

Protein Family: DEFL family

Gene Name: Nil

Source Organism: Pentadiplandra brazzeana

Protein Length: 54 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 2, 'N': 4, 'D': 5, 'C': 8, 'Q': 4, 'E': 4, 'G': 1, 'H': 1, 'I': 1, 'L': 3, 'K': 7, 'M': 0, 'F': 1, 'P': 1, 'S': 2, 'T': 0, 'W': 0, 'Y': 6, 'V': 2

Frequencies of Amino Acids

'A': 3.7%, 'R': 3.7%, 'N': 7.41%, 'D': 9.26%, 'C': 14.81%, 'Q': 7.41%, 'E': 7.41%, 'G': 1.85%, 'H': 1.85%, 'I': 1.85%, 'L': 5.56%, 'K': 12.96%, 'M': 0%, 'F': 1.85%, 'P': 1.85%, 'S': 3.7%, 'T': 0%, 'W': 0%, 'Y': 11.11%, 'V': 3.7%

Missing Amino Acid(s)

M, T, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, G, H, I, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6498.32 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	43.333	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	52.178	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.106	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.569	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.975	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.405	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.241, 0.148, 0.167 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.13	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8940, 9440	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ming D, Hellekant G, Hellekant G. Brazzein, a new high-potency thermostable sweet protein from Pentadiplandra brazzeana B. FEBS Lett. 1994;355(1):106-8. Published 1994 Nov 21. doi:10.1016/0014-5793(94)01184-2

PMID: 7957951

Citation 2: Yount NY, Yeaman MR, Yeaman MR. Multidimensional signatures in antimicrobial peptides. Proc Natl Acad Sci U S A. 2004;101(19):7363-8. Published 2004 May 11. doi:10.1073/pnas.0401567101

PMID: 15118082

Citation 3: Caldwell JE, Abildgaard F, Dzakula Z, et al. Solution structure of the thermostable sweet-tasting protein brazzein. Nat Struct Biol. 1998;5(6):427-31. Published 1998 Jun. doi:10.1038/nsb0698-427

PMID: 9628478

5.2 Protein Sequence Databases

UniProt: P56552

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P56552

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036574

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download