AMPDB_77 | Cecropin-C

PEPTIDE SUMMARY

Cecropin-C

1 General Description

AMPDB ID: AMPDB_77

Protein Names: Cecropin-C

Protein Family: Cecropin family

Gene Name: CecC CG1373

Source Organism: Drosophila melanogaster (Fruit fly)

Protein Length: 63 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 4, 'N': 2, 'D': 1, 'C': 0, 'Q': 5, 'E': 2, 'G': 7, 'H': 1, 'I': 8, 'L': 5, 'K': 4, 'M': 1, 'F': 3, 'P': 0, 'S': 2, 'T': 3, 'W': 1, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 15.87%, 'R': 6.35%, 'N': 3.17%, 'D': 1.59%, 'C': 0%, 'Q': 7.94%, 'E': 3.17%, 'G': 11.11%, 'H': 1.59%, 'I': 12.7%, 'L': 7.94%, 'K': 6.35%, 'M': 1.59%, 'F': 4.76%, 'P': 0%, 'S': 3.17%, 'T': 4.76%, 'W': 1.59%, 'Y': 1.59%, 'V': 4.76%

Missing Amino Acid(s)

C, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6812.99 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	110.159	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.56	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.244	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.945	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.21	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.091	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.333, 0.175, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.079	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tryselius Y, Samakovlis C, Kimbrell DA, et al. CecC, a cecropin gene expressed during metamorphosis in Drosophila pupae. Eur J Biochem. 1992;204(1):395-9. Published 1992 Feb 15. doi:10.1111/j.1432-1033.1992.tb16648.x

PMID: 1740152

Citation 2: Clark AG, Wang L, Wang L. Molecular population genetics of Drosophila immune system genes. Genetics. 1997;147(2):713-24. Published 1997 Oct. doi:10.1093/genetics/147.2.713

PMID: 9335607

Citation 3: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185

PMID: 10731132

Citation 4: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083

PMID: 12537572

Citation 5: Stapleton M, Carlson J, Brokstein P, et al. A Drosophila full-length cDNA resource. Genome Biol. 2002;3(12):RESEARCH0080. Published 2002. doi:10.1186/gb-2002-3-12-research0080

PMID: 12537569

5.2 Protein Sequence Databases

UniProt: O16829

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O16829

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Z11167	GenBank \|\| EMBL
2.	AF019007	GenBank \|\| EMBL
3.	AF019008	GenBank \|\| EMBL
4.	AF019009	GenBank \|\| EMBL
5.	AF019010	GenBank \|\| EMBL
6.	AF019011	GenBank \|\| EMBL
7.	AF019012	GenBank \|\| EMBL
8.	AF019013	GenBank \|\| EMBL
9.	AF019014	GenBank \|\| EMBL
10.	AF019015	GenBank \|\| EMBL
11.	AF019016	GenBank \|\| EMBL
12.	AF019017	GenBank \|\| EMBL
13.	AF019018	GenBank \|\| EMBL
14.	AE014297	GenBank \|\| EMBL
15.	AY113583	GenBank \|\| EMBL