AMPDB_769 | Prophenin-2

PEPTIDE SUMMARY

Prophenin-2

1 General Description

AMPDB ID: AMPDB_769

Protein Names: Prophenin-2 (C12) (PF-2) (PR-2) (Prophenin-1-like)

Protein Family: Cathelicidin family

Gene Name: Nil

Source Organism: Sus scrofa (Pig)

Protein Length: 228 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

METQRASLCLGRWSLWLLLLALVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRRPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEGVRRFPWWWPFLRRPRLRRQAFPPPNVPGPRFPPPNVPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFPGPPFPPPIFPGPWFPPPPPFRPPPFGPPRFPGRR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 25, 'N': 9, 'D': 8, 'C': 5, 'Q': 7, 'E': 10, 'G': 13, 'H': 0, 'I': 3, 'L': 20, 'K': 6, 'M': 1, 'F': 18, 'P': 56, 'S': 8, 'T': 8, 'W': 6, 'Y': 2, 'V': 13

Frequencies of Amino Acids

'A': 4.39%, 'R': 10.96%, 'N': 3.95%, 'D': 3.51%, 'C': 2.19%, 'Q': 3.07%, 'E': 4.39%, 'G': 5.7%, 'H': 0%, 'I': 1.32%, 'L': 8.77%, 'K': 2.63%, 'M': 0.44%, 'F': 7.89%, 'P': 24.56%, 'S': 3.51%, 'T': 3.51%, 'W': 2.63%, 'Y': 0.88%, 'V': 5.7%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

140

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	25855 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	60.263	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	68.545	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.626	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.775	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.143	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	12.706	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.272, 0.377, 0.18 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.114	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	35980, 36230	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Pungercar J, Strukelj B, Kopitar G, et al. Molecular cloning of a putative homolog of proline/arginine-rich antibacterial peptides from porcine bone marrow. FEBS Lett. 1993;336(2):284-8. Published 1993 Dec 27. doi:10.1016/0014-5793(93)80821-b

PMID: 8262247

Citation 2: Zhao C, Ganz T, Lehrer RI, et al. Structures of genes for two cathelin-associated antimicrobial peptides: prophenin-2 and PR-39. FEBS Lett. 1995;376(3):130-4. Published 1995 Dec 4. doi:10.1016/0014-5793(95)01237-3

PMID: 7498526

5.2 Protein Sequence Databases

UniProt: P51525

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P51525

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X75438	GenBank \|\| EMBL
2.	X89202	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_999028.1

5.5 Protein-Protein Interaction Databases

STRING: 9823.ENSSSCP00000021393

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ssc:396871

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download