AMPDB_768 | Prophenin and tritrpticin precursor

PEPTIDE SUMMARY

Prophenin and tritrpticin precursor

1 General Description

AMPDB ID: AMPDB_768

Protein Names: Prophenin and tritrpticin precursor (C6) [Cleaved into: Prophenin-1 (PF-1); Tritrpticin]

Protein Family: Cathelicidin family

Gene Name: Nil

Source Organism: Sus scrofa (Pig)

Protein Length: 212 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

LLLLALVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEGVRRFPWWWPFLRRPRLRRQAFPPPNVPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFPGPPFPPPIFPGPWFPPPPPFRPPPFGPPRFPGRR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 22, 'N': 9, 'D': 8, 'C': 4, 'Q': 7, 'E': 9, 'G': 12, 'H': 0, 'I': 3, 'L': 17, 'K': 6, 'M': 0, 'F': 19, 'P': 56, 'S': 6, 'T': 7, 'W': 4, 'Y': 2, 'V': 12

Frequencies of Amino Acids

'A': 4.25%, 'R': 10.38%, 'N': 4.25%, 'D': 3.77%, 'C': 1.89%, 'Q': 3.3%, 'E': 4.25%, 'G': 5.66%, 'H': 0%, 'I': 1.42%, 'L': 8.02%, 'K': 2.83%, 'M': 0%, 'F': 8.96%, 'P': 26.42%, 'S': 2.83%, 'T': 3.3%, 'W': 1.89%, 'Y': 0.94%, 'V': 5.66%

Missing Amino Acid(s)

H, M

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

132

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	23955.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	57.453	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	65.507	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.662	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.775	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.979	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.766	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.269, 0.392, 0.165 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.118	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	24980, 25230	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Strukelj B, Pungercar J, Kopitar G, et al. Molecular cloning and identification of a novel porcine cathelin-like antibacterial peptide precursor. Biol Chem Hoppe Seyler. 1995;376(8):507-10. Published 1995 Aug. doi:10.1515/bchm3.1995.376.8.507

PMID: 7576250

Citation 2: Harwig SS, Kokryakov VN, Swiderek KM, et al. Prophenin-1, an exceptionally proline-rich antimicrobial peptide from porcine leukocytes. FEBS Lett. 1995;362(1):65-9. Published 1995 Mar 27. doi:10.1016/0014-5793(95)00210-z

PMID: 7698355

Citation 3: Schibli DJ, Nguyen LT, Kernaghan SD, et al. Structure-function analysis of tritrpticin analogs: potential relationships between antimicrobial activities, model membrane interactions, and their micelle-bound NMR structures. Biophys J. 2006;91(12):4413-26. Published 2006 Dec 15. doi:10.1529/biophysj.106.085837

PMID: 16997878

5.2 Protein Sequence Databases

UniProt: P51524

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P51524

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X86031	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download