AMPDB_76 | Defensin beta 4A

1 General Description

AMPDB ID: AMPDB_76

Protein Names: Defensin beta 4A (Beta-defensin 2) (BD-2) (hBD-2) (Defensin; beta 2) (Skin-antimicrobial peptide 1) (SAP1)

Protein Family: Beta-defensin family; LAP TAP subfamily

Gene Name: DEFB4A DEFB102 DEFB2 DEFB4; DEFB4B

Source Organism: Homo sapiens (Human)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

FASTA format

Counts of Amino Acids

'A': 1, 'R': 3, 'N': 0, 'D': 1, 'C': 6, 'Q': 1, 'E': 0, 'G': 8, 'H': 1, 'I': 4, 'L': 8, 'K': 5, 'M': 2, 'F': 6, 'P': 7, 'S': 2, 'T': 3, 'W': 0, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 1.56%, 'R': 4.69%, 'N': 0%, 'D': 1.56%, 'C': 9.38%, 'Q': 1.56%, 'E': 0%, 'G': 12.5%, 'H': 1.56%, 'I': 6.25%, 'L': 12.5%, 'K': 7.81%, 'M': 3.13%, 'F': 9.38%, 'P': 10.94%, 'S': 3.13%, 'T': 4.69%, 'W': 0%, 'Y': 3.13%, 'V': 6.25%

Missing Amino Acid(s)

E, N, W

Most Occurring Amino Acid(s)

G, L

Less Occurring Amino Acid(s)

A, D, H, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7037.66 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.813	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	41.316	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.605	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.52	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.506	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.714	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.375, 0.266, 0.172 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.125	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-candida

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Chemotaxis, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Harder J, Bartels J, Christophers E, et al. A peptide antibiotic from human skin. Nature. 1997;387(6636):861. Published 1997 Jun 26. doi:10.1038/43088

PMID: 9202117

Citation 2: Liu L, Wang L, Jia HP, et al. Structure and mapping of the human beta-defensin HBD-2 gene and its expression at sites of inflammation. Gene. 1998;222(2):237-44. Published 1998 Nov 19. doi:10.1016/s0378-1119(98)00480-6

PMID: 9831658

Citation 3: Diamond G, Kaiser V, Rhodes J, et al. Transcriptional regulation of beta-defensin gene expression in tracheal epithelial cells. Infect Immun. 2000;68(1):113-9. Published 2000 Jan. doi:10.1128/IAI.68.1.113-119.2000

PMID: 10603376

Citation 4: Harder J, Meyer-Hoffert U, Teran LM, et al. Mucoid Pseudomonas aeruginosa, TNF-alpha, and IL-1beta, but not IL-6, induce human beta-defensin-2 in respiratory epithelia. Am J Respir Cell Mol Biol. 2000;22(6):714-21. Published 2000 Jun. doi:10.1165/ajrcmb.22.6.4023

PMID: 10837369

Citation 5: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 6: Yang D, Chertov O, Bykovskaia SN, et al. Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6. Science. 1999;286(5439):525-8. Published 1999 Oct 15. doi:10.1126/science.286.5439.525

PMID: 10521347

Citation 7: KlÃ¼ver E, Schulz A, Forssmann WG, et al. Chemical synthesis of beta-defensins and LEAP-1/hepcidin. J Pept Res. 2002;59(6):241-8. Published 2002 Jun. doi:10.1034/j.1399-3011.2002.00980.x

PMID: 12010514

Citation 8: RÃ¶hrl J, Yang D, Oppenheim JJ, et al. Specific binding and chemotactic activity of mBD4 and its functional orthologue hBD2 to CCR6-expressing cells. J Biol Chem. 2010;285(10):7028-34. Published 2010 Mar 5. doi:10.1074/jbc.M109.091090

PMID: 20068036

Citation 9: Hoover DM, Rajashankar KR, Blumenthal R, et al. The structure of human beta-defensin-2 shows evidence of higher order oligomerization. J Biol Chem. 2000;275(42):32911-8. Published 2000 Oct 20. doi:10.1074/jbc.M006098200

PMID: 10906336

Citation 10: Sawai MV, Jia HP, Liu L, et al. The NMR structure of human beta-defensin-2 reveals a novel alpha-helical segment. Biochemistry. 2001;40(13):3810-6. Published 2001 Apr 3. doi:10.1021/bi002519d

PMID: 11300761

Citation 11: Bauer F, Schweimer K, KlÃ¼ver E, et al. Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity. Protein Sci. 2001;10(12):2470-9. Published 2001 Dec. doi:10.1110/ps.24401

PMID: 11714914

Citation 12: JÃ¤rvÃ¥ M, Phan TK, Lay FT, et al. Human Î²-defensin 2 kills Candida albicans through phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization. Sci Adv. 2018;4(7):eaat0979. Published 2018 Jul. doi:10.1126/sciadv.aat0979

PMID: 30050988

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: O15263

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Z71389	GenBank \|\| EMBL
2.	AF040153	GenBank \|\| EMBL
3.	AF071216	GenBank \|\| EMBL
4.	AJ000152	GenBank \|\| EMBL
5.	BC069285	GenBank \|\| EMBL
6.	BC093983	GenBank \|\| EMBL
7.	BC093985	GenBank \|\| EMBL