AMPDB_757 | Lysozyme

PEPTIDE SUMMARY

Lysozyme

1 General Description

AMPDB ID: AMPDB_757

Protein Names: Lysozyme (EC 3.2.1.17) (1;4-beta-N-acetylmuramidase)

Protein Family: Glycosyl hydrolase 22 family

Gene Name: Nil

Source Organism: Bombyx mori (Silk moth)

Protein Length: 137 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MQKLIIFALVVLCVGSEAKTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHRFDAWYGWKNHCQGSLPDISSC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 8, 'N': 8, 'D': 9, 'C': 9, 'Q': 3, 'E': 6, 'G': 9, 'H': 5, 'I': 6, 'L': 11, 'K': 14, 'M': 2, 'F': 5, 'P': 2, 'S': 11, 'T': 7, 'W': 4, 'Y': 4, 'V': 7

Frequencies of Amino Acids

'A': 5.11%, 'R': 5.84%, 'N': 5.84%, 'D': 6.57%, 'C': 6.57%, 'Q': 2.19%, 'E': 4.38%, 'G': 6.57%, 'H': 3.65%, 'I': 4.38%, 'L': 8.03%, 'K': 10.22%, 'M': 1.46%, 'F': 3.65%, 'P': 1.46%, 'S': 8.03%, 'T': 5.11%, 'W': 2.92%, 'Y': 2.92%, 'V': 5.11%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15667.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.321	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	19.96	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.553	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.734	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.814	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.902	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.27, 0.219, 0.19 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	27960, 28460	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriolytic enzyme, Anti-gram-negative

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lee WJ, Brey PT, Brey PT. Isolation and characterization of the lysozyme-encoding gene from the silkworm Bombyx mori. Gene. 1995;161(2):199-203. Published 1995 Aug 19. doi:10.1016/0378-1119(95)00199-g

PMID: 7665079

Citation 2: Abraham EG, Nagaraju J, Salunke D, et al. Purification and partial characterization of an induced antibacterial protein in the silkworm, Bombyx mori. J Invertebr Pathol. 1995;65(1):17-24. Published 1995 Jan. doi:10.1006/jipa.1995.1003

PMID: 7876591

5.2 Protein Sequence Databases

UniProt: P48816

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P48816

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L37416	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001037448.1

5.5 Protein-Protein Interaction Databases

STRING: 7091.BGIBMGA010439-TA

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001916, IPR019799, IPR000974, IPR023346

PANTHER: PTHR11407

PROSITE: PS00128, PS51348

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: bmor:693015

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download