AMPDB_754 | Beta-defensin 10

PEPTIDE SUMMARY

Beta-defensin 10

1 General Description

AMPDB ID: AMPDB_754

Protein Names: Beta-defensin 10 (BNBD-10) (BNDB-10) (Neutrophil beta-defensin 10)

Protein Family: Beta-defensin family

Gene Name: DEFB10 BNBD10

Source Organism: Bos taurus (Bovine)

Protein Length: 62 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRLHHLLLLLLLVVLSSGSGFTQGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 8, 'N': 2, 'D': 0, 'C': 6, 'Q': 2, 'E': 0, 'G': 7, 'H': 2, 'I': 2, 'L': 13, 'K': 1, 'M': 2, 'F': 1, 'P': 2, 'S': 5, 'T': 2, 'W': 1, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 1.61%, 'R': 12.9%, 'N': 3.23%, 'D': 0%, 'C': 9.68%, 'Q': 3.23%, 'E': 0%, 'G': 11.29%, 'H': 3.23%, 'I': 3.23%, 'L': 20.97%, 'K': 1.61%, 'M': 3.23%, 'F': 1.61%, 'P': 3.23%, 'S': 8.06%, 'T': 3.23%, 'W': 1.61%, 'Y': 1.61%, 'V': 6.45%

Missing Amino Acid(s)

D, E

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, F, K, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6928.42 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	114.677	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.163	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.398	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.65	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.194	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8.807	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.355, 0.258, 0.258 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.048	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7365	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Roosen S, Exner K, Paul S, et al. Bovine beta-defensins: identification and characterization of novel bovine beta-defensin genes and their expression in mammary gland tissue. Mamm Genome. 2004;15(10):834-42. Published 2004 Oct. doi:10.1007/s00335-004-2387-z

PMID: 15520886

Citation 2: Selsted ME, Tang YQ, Morris WL, et al. Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils. J Biol Chem. 1993;268(9):6641-8. Published 1993 Mar 25. doi:

PMID: 8454635

5.2 Protein Sequence Databases

UniProt: P46168

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P46168

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ567990	GenBank \|\| EMBL
2.	AJ567991	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001108556.1

5.5 Protein-Protein Interaction Databases

STRING: 9913.ENSBTAP00000046539

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006080, IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: bta:100141457

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download