AMPDB_747 | Gallinacin-1 alpha
PEPTIDE SUMMARY
Gallinacin-1 alpha
1 General Description
AMPDB ID: AMPDB_747
Protein Names: Gallinacin-1 alpha (Gal-1 alpha) (Antimicrobial peptide CHP2) (Chicken heterophil peptide 2)
Protein Family: Beta-defensin family
Gene Name: Nil
Source Organism: Gallus gallus (Chicken)
Protein Length: 65 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIWG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 5, 'R': 5, 'N': 1, 'D': 1, 'C': 6, 'Q': 2, 'E': 0, 'G': 6, 'H': 1, 'I': 4, 'L': 11, 'K': 5, 'M': 1, 'F': 5, 'P': 2, 'S': 5, 'T': 1, 'W': 1, 'Y': 2, 'V': 1
Frequencies of Amino Acids
'A': 7.69%, 'R': 7.69%, 'N': 1.54%, 'D': 1.54%, 'C': 9.23%, 'Q': 3.08%, 'E': 0%, 'G': 9.23%, 'H': 1.54%, 'I': 6.15%, 'L': 16.92%, 'K': 7.69%, 'M': 1.54%, 'F': 7.69%, 'P': 3.08%, 'S': 7.69%, 'T': 1.54%, 'W': 1.54%, 'Y': 3.08%, 'V': 1.54%
Missing Amino Acid(s)
E
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
D, H, M, N, T, V, W
Hydrophobic Amino Acid(s) Count
36
Hydrophilic Amino Acid(s) Count
29
Basic Amino Acid(s) Count
1
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7285.85 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 102.154 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 24.151 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.475 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.545 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.2 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 8.714 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.369, 0.215, 0.262 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.123 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 8480, 8855 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative), L.monocytogenes (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Zhao C, Nguyen T, Liu L, et al. Gallinacin-3, an inducible epithelial beta-defensin in the chicken. Infect Immun. 2001;69(4):2684-91. Published 2001 Apr. doi:10.1128/IAI.69.4.2684-2691.2001
PMID: 11254635
Citation 2: Harwig SS, Swiderek KM, Kokryakov VN, et al. Gallinacins: cysteine-rich antimicrobial peptides of chicken leukocytes. FEBS Lett. 1994;342(3):281-5. Published 1994 Apr 11. doi:10.1016/0014-5793(94)80517-2
PMID: 8150085
Citation 3: Evans EW, Beach GG, Wunderlich J, et al. Isolation of antimicrobial peptides from avian heterophils. J Leukoc Biol. 1994;56(5):661-5. Published 1994 Nov. doi:10.1002/jlb.56.5.661
PMID: 7964174
5.2 Protein Sequence Databases
UniProt: P46157
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P46157
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AF181951 GenBank || EMBL
2. DQ858337 GenBank || EMBL
3. DQ858297 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR001855
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India