AMPDB_746 | Gallinacin-1

1 General Description

AMPDB ID: AMPDB_746

Protein Names: Gallinacin-1 (Gal-1) (Beta-defensin 1)

Protein Family: Beta-defensin family

Gene Name: GAL1

Source Organism: Gallus gallus (Chicken)

Protein Length: 65 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG

FASTA format

Counts of Amino Acids

'A': 5, 'R': 5, 'N': 0, 'D': 1, 'C': 6, 'Q': 2, 'E': 0, 'G': 6, 'H': 0, 'I': 4, 'L': 11, 'K': 5, 'M': 1, 'F': 5, 'P': 2, 'S': 7, 'T': 1, 'W': 1, 'Y': 2, 'V': 1

Frequencies of Amino Acids

'A': 7.69%, 'R': 7.69%, 'N': 0%, 'D': 1.54%, 'C': 9.23%, 'Q': 3.08%, 'E': 0%, 'G': 9.23%, 'H': 0%, 'I': 6.15%, 'L': 16.92%, 'K': 7.69%, 'M': 1.54%, 'F': 7.69%, 'P': 3.08%, 'S': 10.77%, 'T': 1.54%, 'W': 1.54%, 'Y': 3.08%, 'V': 1.54%

Missing Amino Acid(s)

E, H, N

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, M, T, V, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7208.76 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	102.154	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	34.442	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.554	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.57	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.2	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8.623	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.369, 0.231, 0.262 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.123	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative), L.monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Brockus CW, Jackwood MW, Harmon BG, et al. Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow. Anim Genet. 1998;29(4):283-9. Published 1998 Aug. doi:10.1046/j.1365-2052.1998.00338.x

PMID: 9745666

Citation 2: Xiao Y, Hughes AL, Ando J, et al. A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins. BMC Genomics. 2004;5(1):56. Published 2004 Aug 13. doi:10.1186/1471-2164-5-56

PMID: 15310403

Citation 3: Harwig SS, Swiderek KM, Kokryakov VN, et al. Gallinacins: cysteine-rich antimicrobial peptides of chicken leukocytes. FEBS Lett. 1994;342(3):281-5. Published 1994 Apr 11. doi:10.1016/0014-5793(94)80517-2

PMID: 8150085

Citation 4: Lynn DJ, Higgs R, Gaines S, et al. Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken. Immunogenetics. 2004;56(3):170-7. Published 2004 Jun. doi:10.1007/s00251-004-0675-0

PMID: 15148642

Citation 5: Yoshimura Y, Ohashi H, Subedi K, et al. Effects of age, egg-laying activity, and Salmonella-inoculation on the expressions of gallinacin mRNA in the vagina of the hen oviduct. J Reprod Dev. 2006;52(2):211-8. Published 2006 Apr. doi:10.1262/jrd.17070

PMID: 16394622

Citation 6: Subedi K, Isobe N, Nishibori M, et al. Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus). Reproduction. 2007;133(1):127-33. Published 2007 Jan. doi:10.1530/REP-06-0083

PMID: 17244739

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P46156

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF033335	GenBank \|\| EMBL
2.	AY621316	GenBank \|\| EMBL
3.	AY672653	GenBank \|\| EMBL
4.	DQ677632	GenBank \|\| EMBL
5.	DQ858338	GenBank \|\| EMBL
6.	DQ858324	GenBank \|\| EMBL
7.	DQ858311	GenBank \|\| EMBL
8.	DQ858298	GenBank \|\| EMBL
9.	DQ862462	GenBank \|\| EMBL

RefSeq: NP_990324.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00730000114755

KEGG: gga:395841

5.9 Phylogenomic Databases

GeneTree: ENSGT00730000114755

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download