AMPDB_741 | Bacteriocin carnobacteriocin B2

PEPTIDE SUMMARY

Bacteriocin carnobacteriocin B2

1 General Description

AMPDB ID: AMPDB_741

Protein Names: Bacteriocin carnobacteriocin B2 (Carnocin CP52)

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: cbnB2 canCP52

Source Organism: Carnobacterium maltaromaticum (Carnobacterium piscicola)

Protein Length: 66 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNSVKELNVKEMKQLHGGVNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 3, 'N': 6, 'D': 0, 'C': 2, 'Q': 3, 'E': 3, 'G': 10, 'H': 1, 'I': 2, 'L': 2, 'K': 5, 'M': 2, 'F': 2, 'P': 1, 'S': 8, 'T': 2, 'W': 1, 'Y': 2, 'V': 7

Frequencies of Amino Acids

'A': 6.06%, 'R': 4.55%, 'N': 9.09%, 'D': 0%, 'C': 3.03%, 'Q': 4.55%, 'E': 4.55%, 'G': 15.15%, 'H': 1.52%, 'I': 3.03%, 'L': 3.03%, 'K': 7.58%, 'M': 3.03%, 'F': 3.03%, 'P': 1.52%, 'S': 12.12%, 'T': 3.03%, 'W': 1.52%, 'Y': 3.03%, 'V': 10.61%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, P, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6993.88 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	60.455	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	19.323	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.417	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.564	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.178	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.967	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.242, 0.379, 0.167 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.076	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8605	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Listeria (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Quadri LE, Sailer M, Roy KL, et al. Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV17B. J Biol Chem. 1994;269(16):12204-11. Published 1994 Apr 22. doi:

PMID: 8163526

Citation 2: Herbin S, Mathieu F, BrulÃ© F, et al. Characteristics and genetic determinants of bacteriocin activities produced by Carnobacterium piscicola CP5 isolated from cheese. Curr Microbiol. 1997;35(6):319-26. Published 1997 Dec. doi:10.1007/s002849900262

PMID: 9353214

Citation 3: Wang Y, Henz ME, Gallagher NL, et al. Solution structure of carnobacteriocin B2 and implications for structure-activity relationships among type IIa bacteriocins from lactic acid bacteria. Biochemistry. 1999;38(47):15438-47. Published 1999 Nov 23. doi:10.1021/bi991351x

PMID: 10569926

5.2 Protein Sequence Databases

UniProt: P38580

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P38580

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L29059	GenBank \|\| EMBL
2.	L47121	GenBank \|\| EMBL
3.	U76763	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download