AMPDB_74 | Regenerating islet-derived protein 3-gamma

1 General Description

AMPDB ID: AMPDB_74

Protein Names: Regenerating islet-derived protein 3-gamma (REG-3-gamma) (Pancreatitis-associated protein 3) (Regenerating islet-derived protein III-gamma) (Reg III-gamma) [Cleaved into: Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 15 kDa form]

Protein Family: Nil

Gene Name: Reg3g Pap3

Source Organism: Mus musculus (Mouse)

Protein Length: 174 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MLPRITITIMSWMLLSCLMLLSQVQGEVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA

FASTA format

Counts of Amino Acids

'A': 11, 'R': 7, 'N': 10, 'D': 5, 'C': 7, 'Q': 4, 'E': 7, 'G': 14, 'H': 3, 'I': 6, 'L': 16, 'K': 9, 'M': 7, 'F': 4, 'P': 8, 'S': 27, 'T': 5, 'W': 7, 'Y': 9, 'V': 8

Frequencies of Amino Acids

'A': 6.32%, 'R': 4.02%, 'N': 5.75%, 'D': 2.87%, 'C': 4.02%, 'Q': 2.3%, 'E': 4.02%, 'G': 8.05%, 'H': 1.72%, 'I': 3.45%, 'L': 9.2%, 'K': 5.17%, 'M': 4.02%, 'F': 2.3%, 'P': 4.6%, 'S': 15.52%, 'T': 2.87%, 'W': 4.02%, 'Y': 5.17%, 'V': 4.6%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19307 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.966	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.19	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.261	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.451	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.466	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.841	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.287, 0.339, 0.236 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.115	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	51910, 52285	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

L.monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antimicrobial, Anti-MRSA, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Lectin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Narushima Y, Unno M, Nakagawara K, et al. Structure, chromosomal localization and expression of mouse genes encoding type III Reg, RegIII alpha, RegIII beta, RegIII gamma. Gene. 1997;185(2):159-68. Published 1997 Feb 7. doi:10.1016/s0378-1119(96)00589-6

PMID: 9055810

Citation 2: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 3: Mukherjee S, Partch CL, Lehotzky RE, et al. Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment. J Biol Chem. 2009;284(8):4881-8. Published 2009 Feb 20. doi:10.1074/jbc.M808077200

PMID: 19095652

Citation 4: Cash HL, Whitham CV, Hooper LV, et al. Refolding, purification, and characterization of human and murine RegIII proteins expressed in Escherichia coli. Protein Expr Purif. 2006;48(1):151-9. Published 2006 Jul. doi:10.1016/j.pep.2006.01.014

PMID: 16504538

Citation 5: Cash HL, Whitham CV, Behrendt CL, et al. Symbiotic bacteria direct expression of an intestinal bactericidal lectin. Science. 2006;313(5790):1126-30. Published 2006 Aug 25. doi:10.1126/science.1127119

PMID: 16931762

Citation 6: Brandl K, Plitas G, Schnabl B, et al. MyD88-mediated signals induce the bactericidal lectin RegIII gamma and protect mice against intestinal Listeria monocytogenes infection. J Exp Med. 2007;204(8):1891-900. Published 2007 Aug 6. doi:10.1084/jem.20070563

PMID: 17635956

Citation 7: Huttlin EL, Jedrychowski MP, Elias JE, et al. A tissue-specific atlas of mouse protein phosphorylation and expression. Cell. 2010;143(7):1174-89. Published 2010 Dec 23. doi:10.1016/j.cell.2010.12.001

PMID: 21183079

Citation 8: Vaishnava S, Yamamoto M, Severson KM, et al. The antibacterial lectin RegIIIgamma promotes the spatial segregation of microbiota and host in the intestine. Science. 2011;334(6053):255-8. Published 2011 Oct 14. doi:10.1126/science.1209791

PMID: 21998396

Citation 9: Lai Y, Li D, Li C, et al. The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury. Immunity. 2012;37(1):74-84. Published 2012 Jul 27. doi:10.1016/j.immuni.2012.04.010

PMID: 22727489

Citation 10: Choi SM, McAleer JP, Zheng M, et al. Innate Stat3-mediated induction of the antimicrobial protein Reg3Î³ is required for host defense against MRSA pneumonia. J Exp Med. 2013;210(3):551-61. Published 2013 Mar 11. doi:10.1084/jem.20120260

PMID: 23401489

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: O09049

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	D63361	GenBank \|\| EMBL
2.	D63362	GenBank \|\| EMBL
3.	BC061139	GenBank \|\| EMBL

CCDS: CCDS20258.1

RefSeq: NP_035390.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001304, IPR016186, IPR016187

PANTHER: Not found

PROSITE: PS50041

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000154447

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000154447

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download