AMPDB_734 | Lantibiotic streptococcin A-FF22

PEPTIDE SUMMARY

Lantibiotic streptococcin A-FF22

1 General Description

AMPDB ID: AMPDB_734

Protein Names: Lantibiotic streptococcin A-FF22 (Antibacterial peptide SA-FF22)

Protein Family: Type A lantibiotic family

Gene Name: scnA

Source Organism: Streptococcus pyogenes

Protein Length: 51 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MEKNNEVINSIQEVSLEELDQIIGAGKNGVFKTISHECHLNTWAFLATCCS

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 0, 'N': 5, 'D': 1, 'C': 3, 'Q': 2, 'E': 6, 'G': 3, 'H': 2, 'I': 5, 'L': 4, 'K': 3, 'M': 1, 'F': 2, 'P': 0, 'S': 4, 'T': 3, 'W': 1, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 5.88%, 'R': 0%, 'N': 9.8%, 'D': 1.96%, 'C': 5.88%, 'Q': 3.92%, 'E': 11.76%, 'G': 5.88%, 'H': 3.92%, 'I': 9.8%, 'L': 7.84%, 'K': 5.88%, 'M': 1.96%, 'F': 3.92%, 'P': 0%, 'S': 7.84%, 'T': 5.88%, 'W': 1.96%, 'Y': 0%, 'V': 5.88%

Missing Amino Acid(s)

P, R, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, M, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5666.41 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.765	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	18.198	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.075	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.549	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.5	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.996	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.294, 0.235, 0.275 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.059	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5625	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hynes WL, Ferretti JJ, Tagg JR, et al. Cloning of the gene encoding Streptococcin A-FF22, a novel lantibiotic produced by Streptococcus pyogenes, and determination of its nucleotide sequence. Appl Environ Microbiol. 1993;59(6):1969-71. Published 1993 Jun. doi:10.1128/aem.59.6.1969-1971.1993

PMID: 8328813

Citation 2: Jack RW, Carne A, Metzger J, et al. Elucidation of the structure of SA-FF22, a lanthionine-containing antibacterial peptide produced by Streptococcus pyogenes strain FF22. Eur J Biochem. 1994;220(2):455-62. Published 1994 Mar 1. doi:10.1111/j.1432-1033.1994.tb18643.x

PMID: 8125103

5.2 Protein Sequence Databases

UniProt: P36501

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P36501

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF026542	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_023612114.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007682

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download