AMPDB_733 | Defensin

1 General Description

AMPDB ID: AMPDB_733

Protein Names: Defensin

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Def CG1385

Source Organism: Drosophila melanogaster (Fruit fly)

Protein Length: 92 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQHSRQKRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN

FASTA format

Counts of Amino Acids

'A': 12, 'R': 3, 'N': 4, 'D': 6, 'C': 7, 'Q': 5, 'E': 3, 'G': 4, 'H': 6, 'I': 3, 'L': 7, 'K': 6, 'M': 1, 'F': 4, 'P': 3, 'S': 3, 'T': 2, 'W': 2, 'Y': 1, 'V': 10

Frequencies of Amino Acids

'A': 13.04%, 'R': 3.26%, 'N': 4.35%, 'D': 6.52%, 'C': 7.61%, 'Q': 5.43%, 'E': 3.26%, 'G': 4.35%, 'H': 6.52%, 'I': 3.26%, 'L': 7.61%, 'K': 6.52%, 'M': 1.09%, 'F': 4.35%, 'P': 3.26%, 'S': 3.26%, 'T': 2.17%, 'W': 2.17%, 'Y': 1.09%, 'V': 10.87%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10189.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	86.957	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.752	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.021	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.541	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.437	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.115	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.293, 0.152, 0.25 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.076	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12865	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Dimarcq JL, Hoffmann D, Meister M, et al. Characterization and transcriptional profiles of a Drosophila gene encoding an insect defensin. A study in insect immunity. Eur J Biochem. 1994;221(1):201-9. Published 1994 Apr 1. doi:10.1111/j.1432-1033.1994.tb18730.x

PMID: 8168509

Citation 2: Lazzaro BP, Clark AG, Clark AG. Molecular population genetics of inducible antibacterial peptide genes in Drosophila melanogaster. Mol Biol Evol. 2003;20(6):914-23. Published 2003 Jun. doi:10.1093/molbev/msg109

PMID: 12716986

Citation 3: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185

PMID: 10731132

Citation 4: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083

PMID: 12537572

Citation 5: Verleyen P, Baggerman G, D'Hertog W, et al. Identification of new immune induced molecules in the haemolymph of Drosophila melanogaster by 2D-nanoLC MS/MS. J Insect Physiol. 2006;52(4):379-88. Published 2006 Apr. doi:10.1016/j.jinsphys.2005.12.007

PMID: 16510152

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P36192

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Z27247	GenBank \|\| EMBL
2.	AY224631	GenBank \|\| EMBL
3.	AY224632	GenBank \|\| EMBL
4.	AY224633	GenBank \|\| EMBL
5.	AY224634	GenBank \|\| EMBL
6.	AY224635	GenBank \|\| EMBL
7.	AY224636	GenBank \|\| EMBL
8.	AY224637	GenBank \|\| EMBL
9.	AY224638	GenBank \|\| EMBL
10.	AY224639	GenBank \|\| EMBL
11.	AY224640	GenBank \|\| EMBL
12.	AY224641	GenBank \|\| EMBL
13.	AY224642	GenBank \|\| EMBL
14.	AE013599	GenBank \|\| EMBL
15.	BT023384	GenBank \|\| EMBL

RefSeq: NP_523672.1

5.5 Protein-Protein Interaction Databases

STRING: 7227.FBpp0087518

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: dme:Dmel_CG1385

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download