AMPDB_731 | Brevinin-1E

PEPTIDE SUMMARY

Brevinin-1E

1 General Description

AMPDB ID: AMPDB_731

Protein Names: Brevinin-1E

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: Nil

Source Organism: Pelophylax lessonae (Pool frog) (Rana lessonae)

Protein Length: 71 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKSMLLLFFLGTINLSLCEEERDADEEERRDNPDESEVEVEKRFLPLLAGLAANFLPKIFCKITRKC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 5, 'N': 3, 'D': 4, 'C': 3, 'Q': 0, 'E': 10, 'G': 2, 'H': 0, 'I': 3, 'L': 12, 'K': 6, 'M': 2, 'F': 6, 'P': 3, 'S': 3, 'T': 3, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 5.63%, 'R': 7.04%, 'N': 4.23%, 'D': 5.63%, 'C': 4.23%, 'Q': 0%, 'E': 14.08%, 'G': 2.82%, 'H': 0%, 'I': 4.23%, 'L': 16.9%, 'K': 8.45%, 'M': 2.82%, 'F': 8.45%, 'P': 4.23%, 'S': 4.23%, 'T': 4.23%, 'W': 0%, 'Y': 0%, 'V': 2.82%

Missing Amino Acid(s)

H, Q, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

G, M, V

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8266.65 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	96.197	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.172	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.179	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.778	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.628	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.17	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.324, 0.155, 0.394 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.085	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Simmaco M, Mignogna G, Barra D, et al. Antimicrobial peptides from skin secretions of Rana esculenta. Molecular cloning of cDNAs encoding esculentin and brevinins and isolation of new active peptides. J Biol Chem. 1994;269(16):11956-61. Published 1994 Apr 22. doi:

PMID: 8163497

Citation 2: Simmaco M, Mignogna G, Barra D, et al. Novel antimicrobial peptides from skin secretion of the European frog Rana esculenta. FEBS Lett. 1993;324(2):159-61. Published 1993 Jun 14. doi:10.1016/0014-5793(93)81384-c

PMID: 8508915

5.2 Protein Sequence Databases

UniProt: P32412

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P32412

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X77831	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012520, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download